KEGG   Rhodococcus pyridinivorans: Y013_07900Help
Entry
Y013_07900        CDS       T02974                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00564  Glycerophospholipid metabolism
rpy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Y013_07900
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Y013_07900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N AlaDh_PNT_C Thi4 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHD20596
UniProt: V9XAX6
LinkDB All DBs
Position
complement(1656512..1658242)
Genome map
AA seq 576 aa AA seqDB search
MTNQSGVQLLGPQQRADAWRRLATEQFDVVVIGGGVVGAGAALDAATRGLRVALVEARDF
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELALTTLAPHLVRPLKFLFPLTHRVW
ERPYVAAGIFLYDRLGGAKSVPAQKHLTRSGALRMVPGLKRNSLVGGIRYYDTVVDDARH
TMTVARTAAHYGAVVRTSTQVVGFLREADRVSGVRVRDSEDGSVTEVRAHAVINATGVWT
DEIQSLSRQRGPFRVRASKGVHIVVPRDRIVSDSAIILRTEKSVLFVIPWGNHWIIGTTD
TDWNLDLAHPAATKADIDYILDHVNRVLVVPLTHDDIDGVYAGLRPLLAGESDETSKLSR
EHAVARVAPGLVAIAGGKYTTYRVMAEDAVDLAAEDIPARIASSITEKVPLVGADGYFAL
VNQTMHLAEQYGLHPYRVKHLLDRYGSLVEDVLSLAKGRPELLEPLTDAPQYLQVEMVYG
AAAEGALHLEDLLARRTRISIEYPHRGLHCAEQTARLVAPVLGWDDATIDREVATYRARV
EAEIESQNRPDDESADALRAAAPEARPEILEPVPIT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaccaatcgggtgtgcaactcctcggaccgcaacagcgcgccgacgcctggcgt
cgtctcgccaccgaacagttcgacgtcgtcgtcatcggcggtggtgtcgtcggggcggga
gcagcactcgacgccgcgacccggggcctgcgagtcgctctcgtcgaggcccgcgacttc
gcgtccggcacgtcgagccggtcgtcgaagatgttccacggcggcctgcgctatctcgaa
cagctcgaattcggtctggtgcgagaagccttgcgcgagcgcgaactcgcattgacgacc
ctggccccgcacctggtcaggccgttgaagttcctcttcccgctcacccatcgggtgtgg
gagcggccctacgtcgcggcgggcatcttcctctacgaccgtctcggtggcgcgaagtcc
gttccggcgcagaagcacctgacccgctcgggcgccctacggatggttcccggtctcaag
cgcaattcgctcgtcggcggaatccgctactacgacacggtcgtcgacgacgcccggcac
accatgaccgtcgcgcggacggccgcgcactacggtgcggtggtgcgtacgtcgacgcag
gtcgtcggtttcctgcgcgaggccgaccgcgtgtcgggtgtgcgggtgcgcgacagcgag
gacggttcggtcaccgaggtgcgagcgcacgcggtgatcaacgcgaccggtgtgtggacc
gacgagatccagtcgttgtcgcggcagcgcggcccattccgggtccgcgcgtcgaagggc
gtgcacatcgtcgtgccccgcgaccggatcgtcagcgattcggcgatcatcctgcgtacc
gagaagtcggtgctgttcgtcatcccgtggggcaaccactggatcatcggcaccaccgac
accgactggaatctcgacctggcgcacccggcggcgacgaaggccgacatcgactacatc
ctcgaccacgtcaaccgcgtactcgtcgtcccgctcacccacgacgacatcgacggtgtc
tacgctggtctgcgcccgctgctggcgggggagagcgacgagacgtccaagctctcgcgt
gaacacgccgtcgcgcgggtggcgccggggctcgtggcgatcgccggtggcaagtacacg
acctaccgcgtcatggccgaggacgccgtcgatctcgcggccgaggacatcccggcccgg
atcgcgtcgtcgatcaccgagaaggtgccccttgtcggggccgacgggtacttcgcgctg
gtcaaccagaccatgcatctcgccgagcagtacggtctgcatccctaccgcgtcaagcat
ctgctcgaccgctacggctccctcgtcgaggacgtgctgagccttgcgaagggccggccc
gagttgctcgaaccgctgaccgatgccccccagtacctgcaggtcgagatggtctacggc
gctgcggccgaaggagccctacatctcgaggacctcctggcgcgccggacccggatctcg
atcgaatacccgcaccgcgggctgcactgtgcggagcagacggcccggctggtcgctccg
gtcctcggctgggacgacgcgacgatcgaccgggaagtcgcgacctaccgggcgcgcgtc
gaggcggagatcgagtcgcagaaccgacccgacgacgaatccgcggacgcgctccgggca
gcggccccggaggcccggccggagatcctcgaaccggtgcccatcacgtag

DBGET integrated database retrieval system