KEGG   Rhodococcus pyridinivorans: Y013_08055Help
Entry
Y013_08055        CDS       T02974                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00020  Citrate cycle (TCA cycle)
rpy00480  Glutathione metabolism
rpy01100  Metabolic pathways
rpy01110  Biosynthesis of secondary metabolites
rpy01120  Microbial metabolism in diverse environments
rpy01130  Biosynthesis of antibiotics
rpy01200  Carbon metabolism
rpy01210  2-Oxocarboxylic acid metabolism
rpy01230  Biosynthesis of amino acids
Module
rpy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y013_08055
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Y013_08055
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Y013_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHD20626
UniProt: V9XB08
LinkDB All DBs
Position
complement(1688161..1689378)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGKVVELDGDEMTRIIWQFIKDKLIHPYLDVDLEYYDLGVENRDATDDQVTVDA
ANAIKKHNVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPVIVGRHAFGDQYRATDFKVDRPGTVTITFTPEDGSEPIQHEVCQIPEDGGVVM
GMYNYKKSIQDFARASLSYGLQRNYPVYLSTKNTILKAYDGMFKDEFQRIYEEEFKAEFD
AAGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIEFAQQLE
DVVIKTVEAGQMTKDLALLVGPEQGWLTTEEFLAALDENLQKARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggtaaggtcgtcgagctcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtggatctcgag
tactacgacctcggcgtggagaaccgcgacgccaccgacgaccaggtgacggtcgatgcg
gcgaacgccatcaagaagcacaacgtcggcgtcaagtgcgccaccatcacccccgacgaa
gcgcgtgtcgaggagttcggcctgaagaagatgtggcggtcgcccaacggcaccatccgt
aacatcctcggcggcaccatcttccgcgcgcccatcatcatctcgaacgtgccgcgtctg
gtgccgggctggaccaagcccgtcatcgtcggccgtcacgcgttcggcgatcagtaccgc
gccaccgacttcaaggtcgaccgcccgggcaccgtcaccatcaccttcacgcccgaggac
ggcagcgagccgatccagcacgaggtctgccagatccccgaggacggcggcgtcgtgatg
ggtatgtacaactacaagaagtccatccaggacttcgcgcgcgcctcgctctcgtacggc
ctgcagcgcaactacccggtctacctgtcgaccaagaacacgatcctgaaggcctacgac
ggcatgttcaaggacgagttccagcggatctacgaggaagagttcaaggcggagttcgac
gccgccggtctcacctacgagcaccgcctcatcgacgacatggtcgcatcgtccctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggctacggctcgctggggctgatgacctccgtcctgatgaccccggatggc
aagaccgtcgaggcggaggccgcacacggcaccgtcacccggcactaccgtcagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcctggacccgtggcctc
gagcaccgcggcaagctggacaacacccccgaggtcatcgagttcgcgcagcagctcgag
gacgtcgtcatcaagaccgtcgaagccggtcagatgaccaaggacctcgccctgctcgtc
ggccccgagcagggctggctgaccaccgaggagttcctcgcagcactcgacgagaacctg
cagaaggctcgcgcctga

DBGET integrated database retrieval system