KEGG   Rhodococcus pyridinivorans: Y013_08910Help
Entry
Y013_08910        CDS       T02974                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpy  Rhodococcus pyridinivorans
Brite
Translation factors [BR:rpy03012]
 Eukaryotic Type
  Elongation factors
   Y013_08910
 Prokaryotic Type
   Y013_08910
Mitochondrial biogenesis [BR:rpy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Y013_08910
Exosome [BR:rpy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Y013_08910
  Exosomal proteins of breast cancer cells
   Y013_08910
  Exosomal proteins of colorectal cancer cells
   Y013_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHD20776
UniProt: V9XBH1
LinkDB All DBs
Position
complement(1934728..1935918)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADKFPDLNESFAFDQIDKAPEEKA
RGITINISHVEYQTDKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKADMVDDEEILELVEMEVRELLASQEFDENAPVVPISALKAL
EGDEKWVQSIVDLMQAVDDSIPDPVRETDKPFLMPVEDVFTITGRGTVVTGRIERGVINV
NEEVEIVGIRPESTKTTVTGIEMFRKLLDQGQAGDNVGLLVRGIKREDVERGQVVVKPGT
TTPHTEFEGQAYILNKEEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNTE
MSVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttcgagcggaccaagccgcacgtgaacatcggcaccatcggtcac
gtcgaccacggcaagaccaccaccacggctgcgatcaccaaggtgcttgccgacaagttc
cccgacctgaacgagagcttcgctttcgatcagatcgacaaggcacctgaggagaaggct
cgtggtatcacgatcaacatctcccacgtcgagtaccagaccgacaagcgccactacgcg
cacgtcgacgccccgggtcacgcggactacatcaagaacatgatcaccggtgccgcccag
atggacggcgcgatcctggtcgtggccgccaccgacggcccgatgccccagacgcgtgag
cacgtgctgctcgcccgccaggtcggcgttccctacatcctcgtcgccctgaacaaggcc
gacatggtcgacgacgaggaaatcctcgagctcgtcgagatggaggtgcgcgagctcctc
gcttcgcaggagttcgacgagaacgctccggtcgtcccgatctccgctctcaaggctctc
gagggtgacgagaagtgggtccagtcgatcgtcgacctcatgcaggccgtcgacgactcc
atcccggacccggtccgtgagaccgacaagccgttcctcatgcccgtcgaggacgtcttc
acgatcacgggtcgtggcaccgtcgtcaccggccgtatcgagcgtggcgtgatcaacgtc
aacgaagaggtcgagatcgtcggcatccgccccgagtcgaccaagaccacggtcaccggc
atcgagatgttccgcaagctgctcgaccagggccaggccggcgacaacgtcggtctcctc
gtccgcggcatcaagcgcgaggacgtcgagcgcggccaggtcgtcgtcaagccgggcacc
acgactccccacacggagttcgagggccaggcctacatcctcaacaaggaggagggcggc
cgccacacgccgttcttcaacaactaccgcccgcagttctacttccgtaccacggacgtg
acgggcgttgtgaccctccccgagggcaccgagatggtcatgcccggtgacaacaccgag
atgtccgtcaagctgatccagccggtcgccatggacgagggcctccgcttcgcgatccgc
gagggtggccgcaccgtcggcgccggtcgcgtcacgaagatcatcaagtag

DBGET integrated database retrieval system