KEGG   Rhodococcus pyridinivorans: Y013_11580Help
Entry
Y013_11580        CDS       T02974                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rpy  Rhodococcus pyridinivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHD21263
UniProt: V9XFW5
LinkDB All DBs
Position
2501834..2503282
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLFIGGRWVAPSTDERLEVFSPATEERVGSVPVAGPQDIDAAVSAARTAFDEGPW
SRTTPSERAEILGKAAKLIEERRAEIGASLTAEMGQPPASVEMMQLTSGLATLDYYAGLA
DSFPWTEERTGLFGRSRVSREPVGVVAAVIAWNVPLFLMLNKLGPALLAGCTVVLKPAPE
SPLTTNVLAEIFTEAGLPEGVLSLVPGGAETGEYLVSHPDVDKITFTGSTAVGRHIGEIA
ARGLKRCSLELGGKSAAIILEDADLDSTMPMLVMSGLMNTGQACVGQTRVLAPRSRYDEV
IEKMTATAAFFPVGLPDTEGAQLGPLISAKQRDRVESYIAKGKEEGARLVLGGGRPEGIE
TGYFVEPTIFADVDNSMTIAREEIFGPVICVIPYDSVDEAVKIANDSDYGLAGSVYTTDV
EKGLEIASRVRTGTYGINWYAFDPGSPFGGYKNSGIGRENGPEGVEAYCETKSVLYPLGY
EG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaagttgttcatcggcggccgatgggtggcaccgtcgaccgacgag
agactcgaggtgttctcccccgccacggaagagcgcgtcggttccgtgcccgtcgcggga
ccgcaggacatcgatgccgcggtgtccgccgcccgcacggccttcgacgaaggcccgtgg
tcgcgcaccaccccgagcgagcgcgccgagatcctcggcaaggcagcaaagctcatcgag
gagcgtcgtgcggagatcggcgcctcgctcaccgcggagatgggccagccgccggcctcg
gtcgagatgatgcagctgacgtcgggcctggccacactcgactactatgcggggcttgcc
gattcgttcccgtggaccgaggagcgcaccggcctgttcggtcgcagccgcgtcagccgc
gaacccgtcggcgtcgtcgccgccgtcatcgcgtggaacgtgccgctgttcctgatgctc
aacaaactcggacccgccctgctcgccggatgcacggtggtcctcaagcccgctcccgaa
tcgccgctgacgacgaacgtcctcgccgagatcttcacggaggcaggacttcccgagggc
gtcctctcactcgtgcccggcggcgccgagaccggcgagtacctggtctcgcaccccgac
gtcgacaagatcaccttcaccggttcgacggccgtgggtcgtcacatcggtgagatcgcc
gcgcgcggactcaagcgctgctcactcgaactcggcggcaagtcggcagcgatcatcctc
gaggacgccgacctcgactcgacgatgccgatgctggtgatgtccggcctgatgaacacc
ggtcaggcctgcgtcgggcagacccgcgtcctcgcgccgcggtcgcgctacgacgaggtg
atcgagaagatgaccgcgaccgcggccttcttccccgtcggactgcccgataccgaaggc
gcacaactcggtccgctgatctccgcgaagcagcgcgatcgcgtcgagtcctacatcgcc
aagggcaaggaggaaggcgcgcgtctcgtgctcggcggtggtcgccccgagggcatcgag
acgggctacttcgtcgaaccgacgatcttcgccgacgtcgacaactccatgaccatcgcc
cgcgaggagatcttcggacctgtcatctgcgtgattccctacgacagcgtcgacgaggcc
gtgaagatcgccaacgattccgactacggcctggccggttcggtgtacaccaccgacgtc
gagaagggcctcgagatcgcctcgcgcgtgcgcaccggcacgtacggaatcaactggtac
gcattcgatccgggttcaccgttcggcggctacaagaactccggtatcggccgcgagaac
ggtcccgagggcgtcgaggcgtactgcgaaaccaagtcggtgctgtacccgctcggttac
gagggctga

DBGET integrated database retrieval system