KEGG   Rhodococcus pyridinivorans: Y013_12145Help
Entry
Y013_12145        CDS       T02974                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rpy  Rhodococcus pyridinivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AHD21366
UniProt: V9XD55
LinkDB All DBs
Position
complement(2617781..2618845)
Genome map
AA seq 354 aa AA seqDB search
MDLPVVPPIAPMLAKVSSTVPSQPEDGPDEWSYEPKWDGFRAIVFRDGDEVVLGSRGGKD
LVRYFPELADAARAELPRRCVVDGEIVVPREHDGRTRLDWQALSERIHPAASRVTMLAEQ
TPAVFVGFDLLALADENLMETPSAERRARLRSEIGGGKSCHVTVATTDTDTARRWFEEFE
GAGLDGVIAKRLDGLYVPDKREMLKLKHARTADCVLMGYRMHKSVEGIGSLLLGLYHDGE
LTMVGGASAFTRERREELLAELQPLRLGDDVVEQGEPTRWRSAVDRSWVPLRPERVVEVA
YDQMEGVSGAGMRFRHAAKFLRWRPDRDPESCTFDQLEVPVRYDLSDVLDRTED
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgtggtgccgccgatcgccccgatgctcgccaaggtctcctccaccgtc
ccctcccaacccgaagacggtcccgacgagtggtcctacgaacccaaatgggacggtttc
cgggcgatcgtcttccgcgacggtgacgaggtggttctcggctcgcgcggaggtaaggac
ctcgtgcgctacttcccggaactcgccgacgccgcgcgcgccgaactgccccgcaggtgc
gtggtcgacggggagatcgtcgtcccgcgcgaacacgacggccgcacccgactcgactgg
caggcgctgtccgagcggatccatccggccgccagccgggtcacgatgctcgccgagcag
acaccggccgtgttcgtcggtttcgatctgctcgctctcgccgacgagaatctcatggag
accccgtccgcggagcggcgcgcgcggctgcggtccgagatcggcgggggtaagagctgt
catgtcacggtggccacgaccgacaccgataccgcccgccgctggttcgaggagttcgaa
ggggccggcctcgacggcgtgatcgccaagcgactcgacgggctctatgtgcccgacaag
cgggagatgctcaagctcaaacatgcccgcaccgccgactgcgtcctcatgggctaccgc
atgcacaagagcgtcgagggaatcgggtcgttgctgctcgggctctatcacgacggcgaa
cttacgatggtcggcggagcctcggcgttcacgcgggagcggcgcgaggaactgctcgcc
gaactgcaaccgctgcgactcggggacgacgtcgtcgagcagggcgaaccgacgcggtgg
cgttcggcggtggaccgcagctgggtgccgttgcgtcccgaacgtgtcgtggaggtcgcg
tacgaccagatggaaggtgtgtcgggagcggggatgcggttccggcacgcagcgaagttc
ctgcggtggcgtcccgaccgtgaccccgagagctgcacgttcgaccagctggaggtgccg
gtgcgctacgacctgtcggatgtgctcgaccggacggaggactga

DBGET integrated database retrieval system