KEGG   Rhodococcus pyridinivorans: Y013_15480Help
Entry
Y013_15480        CDS       T02974                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rpy  Rhodococcus pyridinivorans
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Y013_15480
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Y013_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C HI0933_like FAD_binding_3 DAO NAD_binding_7 NAD_binding_8 Thi4 K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AHD21951
UniProt: V9XFP6
LinkDB All DBs
Position
complement(3346304..3347899)
Genome map
AA seq 531 aa AA seqDB search
MLDASLAAQLKSLLEKVTQPIELVSSLDDRPKSKELADLLDQIAGMSDLVTHVRDGEAAR
RPSFLIRRVGTDIAVEFAGIPLGHEFTSLVLALLQVGGHPSKEAVELLEQVRDLEGDFHF
ETYFSLSCQNCPDVVQALNVMCVTNSRIKHTAIEGSLFQDEVDARQVMAVPTVFLNGELF
GSGRMNLEQIVGKLDSGSAERTAAAISEKDPFDVLVVGGGPAGATAAIYASRKGIRTGVL
AERFGGQVLDTMAIENFSSVPYTEGPKFAAELENHVRQYDVDIMNVQKASKLTPAPTEGG
LVEVELENGARLLSRSVVLATGARWRAMNVPGEQEYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVAHVTLIEFDSVLRADEVLQRKLRSLPNVDIIVSALTTEVLGDG
SKVTGLTYTDRTTDESRTLELDGVFVQIGLLPNTEWLTGTVELSPRGEIVVDDHGRTSVP
GVFAAGDCTTVPYKQIIVSAGAGATAALGAFDHLIRTSAPAQAEEAVAATV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctccctcgccgcccagttgaagtcccttctcgaaaaggtcacccagccg
atcgagctcgtgtcgtccctcgacgaccggccgaagtcgaaggaactcgccgacctcctc
gatcagatcgccggcatgtccgatctggtcacccatgtgcgcgacggtgaagccgcccgt
cgcccctccttcctgatccgccgggtcggcaccgacatcgcggtcgagttcgcgggcatc
ccgctcggccacgagttcacctccctcgtgctcgccctgctgcaggtcggcggacacccc
tcgaaggaggccgtggagctgctcgagcaggtgcgcgacctcgagggcgacttccacttc
gagacctacttctcgctgtcgtgccagaactgccccgacgtggtgcaggccctgaacgtg
atgtgcgtgaccaactcgcgcatcaagcacaccgccatcgaaggctcgctcttccaggac
gaggtcgacgcacgccaggtgatggcagtgccgaccgtcttcctcaacggtgagctgttc
ggctccggccggatgaacctcgagcagatcgtcggcaagctcgacagcggctccgccgag
cgcaccgccgccgcgatcagcgagaaggatcccttcgacgtcctcgtcgtcggtggcggc
cccgccggcgcgactgccgcgatctacgcctcccgcaagggaatccgcaccggcgttctc
gccgagcgcttcggcggccaggtgctcgacaccatggccatcgagaacttctcctccgtt
ccctacacggagggcccgaagttcgccgccgagctcgagaaccacgtgcgccagtacgac
gtcgacatcatgaacgtccagaaggcctcgaagctcaccccggcccccaccgagggtggt
ctcgtcgaggtcgagctcgagaacggcgcccggttgctctcgcgcagcgtcgttctcgcg
accggtgcccgctggcgcgcgatgaacgtgccgggcgagcaggaataccgcaacaagggt
gtcacctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcatc
ggtggcggtaactccggtgtcgaggccgcgatcgacctcgccggcgtcgtcgcccacgtg
accctcatcgagttcgactcggtcctgcgcgccgacgaggtgctgcagcgcaagctccgc
agcctgcccaacgtcgacatcatcgtcagcgccctcaccaccgaggtcctcggcgacggt
tcgaaggtcaccggcctgacctacaccgaccgcaccaccgacgagtcgcgcaccctcgag
ctcgacggcgtgttcgtccagatcggtctgctgccgaacaccgaatggctcaccggcacg
gtcgaactcagtccgcgcggcgagatcgtcgtcgacgatcacggccgcacctcggtgccc
ggcgtgttcgccgccggcgactgcacgaccgtcccgtacaagcagatcatcgtctccgca
ggtgcgggtgcgacggccgcgctcggcgcgttcgaccacctcatccgcacgagcgccccg
gcccaggccgaggaagcggtcgctgcgaccgtctag

DBGET integrated database retrieval system