KEGG   Rhodococcus pyridinivorans: Y013_19050Help
Entry
Y013_19050        CDS       T02974                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00250  Alanine, aspartate and glutamate metabolism
rpy00410  beta-Alanine metabolism
rpy00640  Propanoate metabolism
rpy00650  Butanoate metabolism
rpy01100  Metabolic pathways
rpy01120  Microbial metabolism in diverse environments
Module
rpy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Y013_19050
   00650 Butanoate metabolism
    Y013_19050
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y013_19050
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Y013_19050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpy01007]
    Y013_19050
Enzymes [BR:rpy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Y013_19050
Amino acid related enzymes [BR:rpy01007]
 Aminotransferase (transaminase)
  Class III
   Y013_19050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHD22573
UniProt: V9XJM3
LinkDB All DBs
Position
4068755..4069996
Genome map
AA seq 413 aa AA seqDB search
MTRLSPRLLQATPVTVDHAEGCYIHGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQIG
SLIHGQYTTVMHRPLLELTERLGTVLPEGLDSLFFANSGSEAVEAALRLARQATGRPGIV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMGGVHVAPFPTAYRYGWSEEEATDFALQEL
DYLFATLVAPDEIAAFVVEPVLGEGGYVPGNTRFFQGLRQRADEHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMERARPGSQGGTYGANAVSCAA
AVATLDVIEKEGLVDNAAVRGRELLSGARENTTDAIGDVRGLGLMVGLEFTADGAPDRER
ATAAQQLAAQKGLLLLTCGAHMNVVRMIPPLIVTAQQIEDALGTWSEVLAEVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctttcaccccgcctgctgcaggcaacgcccgtcaccgtcgaccacgccgag
gggtgctacatccacggcaccgacggacgtcggtatctcgacttcaccgccggcatcggc
gtcacgagtaccggccactgtcacccgcacgtcgtcgaggccgcccgccggcagatcggc
tcgctgatccacgggcagtacacgaccgtgatgcaccggcccctgctcgaactcaccgaa
cgcctgggcacggtgctccccgaaggactcgactcgctgttcttcgccaattcgggcagc
gaggcagtcgaggcggcgctgcgtctggcccgccaggcgacagggcgacccggaatcgtc
gtcttccacggcggtttccacggccgtaccgtcgccgccgccacgatgaccacctccgga
acccgtttctccgcagggttctcgccgctcatgggcggtgtacacgtcgctcccttcccc
acggcctatcgctacggctggtcggaggaggaagcgaccgatttcgccctgcaggaactg
gactacctgttcgcgaccctcgtggcgccggacgagatcgcggccttcgtcgtcgaaccg
gtcctgggcgagggcggttacgtccccggcaacaccaggttcttccagggactgcggcag
cgggccgacgaacacggcatcctgctcgtcttcgacgagatccagaccggattcgggcgg
accggaaagttcttcgggcatcagcacttcgacgtgcgacccgacatcatcaccatcgcc
aagggcctcgcgagcggtttcccgctgtcgggtatcgccgcctccgaggaactcatggaa
cgcgcccgtccgggatcgcagggcggcacgtacggggcgaatgcggtctcgtgcgcggcg
gccgtggccactctcgacgtgatcgagaaggaggggctcgtcgacaatgccgccgtgcgt
ggacgtgaactgctctccggcgcacgggagaacacgaccgatgccatcggtgacgtgcgc
ggcctcggtctcatggtgggcctcgagttcaccgcggacggagcacccgaccgggaacgg
gcgaccgcagcgcaacaactcgccgcccagaagggtttgctgctgttgacctgcggtgca
cacatgaacgtggtgcgcatgatccccccgttgatcgtcaccgcccagcagatcgaggac
gcgctcgggacctggtccgaggtcctcgccgaggtccgataa

DBGET integrated database retrieval system