KEGG   Rhodococcus qingshengii: C1M55_05435Help
Entry
C1M55_05435       CDS       T05315                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rqi  Rhodococcus qingshengii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AUS30609
LinkDB All DBs
Position
1:complement(1184192..1185637)
Genome map
AA seq 481 aa AA seqDB search
MTDYDKLYIGGAWVAPATDQVLEVFSPATEERVGSCPIAAPANIDAAVSAARAAFEGPWS
RTTPAERGAILAKAAKLIEERSAEINQLISNEMGQPPAMVGMMQQTPSMATLGYYAELAD
KFAWEEKRTGAFGQTKVTREPVGVVAAVLAWNVPLFLAINKLAPALLAGCTVLLKPAPES
PLSVHVIAEIFTEAGVPEGVISVLPGGAETGEYLVSHAGIDKITFTGSSAVGRKIGAIAA
QNLKRCSLELGGKSAAIILEDADIAAGMPMLVMSGLMNTGQACVAQTRILAPRSRYDEVI
EGMKTAAGFMTVGDPSDPAAQLGPLISEKQRERVEGYIAKGKEEGARVVLGGGRPAGLDK
GWYVEPTIFADVDNSMTIAREEIFGPVLSVIPYDSEDEAIKIANDSDYGLAGSVWTTDID
HGLEVAAQIRTGTYAINWYAFDPGSPFGGYKNSGIGRENGPEGLEAFCETKSVLMPPGYV
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgacaagctctacatcggtggagcatgggtggccccggccaccgaccag
gtactcgaagtgttctctcccgcaacggaggagcgcgtcggcagctgtcccatcgcagca
ccggcaaacatcgacgcggccgtgtccgcagcccgcgcggcgttcgagggaccgtggtca
cgcaccacccccgccgagcgcggcgcgatcctcgccaaggccgccaagctgatcgaagag
cgcagcgcggagatcaaccagctcatctccaacgagatgggccagccgcccgccatggtc
ggcatgatgcagcagaccccgtcgatggcgacgctgggctactacgccgagctggccgac
aagttcgcgtgggaagagaagcgcaccggcgctttcgggcagaccaaggtgacccgtgag
cccgtcggcgtcgtcgccgccgtgctggcctggaacgtcccgctgttcctggcgatcaac
aagctggcccccgcactgctcgccggctgcaccgtactgctcaagcccgcacccgaatcc
cctctctccgtccacgtgatcgccgagatcttcaccgaggcaggcgttcccgaaggcgtc
atctccgtgctccccggcggagccgagaccggcgaatacctggtctctcatgcgggcatc
gacaagatcacgttcaccggatccagtgccgtcggccgcaagatcggtgccatcgccgca
cagaacctcaagcgctgctccctcgaactgggtggcaagtccgccgcgatcatcctcgag
gacgccgacatcgccgccggaatgccgatgctcgtcatgtccggcctgatgaacaccggt
caggcctgtgtcgctcagacccgaatcctcgctccccgttcgcgttacgacgaggtcatc
gagggaatgaagaccgccgcaggcttcatgaccgtcggcgatccgtccgatcccgcagca
caactcggcccgctgatctccgagaagcagcgcgagcgcgtcgagggttacatcgccaag
ggtaaggaagaaggcgcgcgcgtcgtactcggtggtggacgccccgccggcctggacaag
ggctggtacgtcgagccgaccatcttcgccgacgtggacaactcgatgaccatcgcacgc
gaggagatcttcggacccgttctctcggtgattccgtacgactccgaggacgaggccatc
aagatcgccaacgattcggattacggcctcgccggatcggtgtggaccaccgacatcgat
cacggactcgaagttgctgcgcagatccgcacgggtacctacgcgatcaactggtacgcc
ttcgatcccggatcgccgttcggtggttacaagaactccggtatcgggcgcgagaacgga
cctgagggcctcgaagccttctgcgagaccaagtccgtactcatgccgcccggctacgtg
ggctga

DBGET integrated database retrieval system