KEGG   Rhodococcus qingshengii: C1M55_12610Help
Entry
C1M55_12610       CDS       T05315                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi00473  D-Alanine metabolism
rqi00550  Peptidoglycan biosynthesis
rqi01100  Metabolic pathways
rqi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C1M55_12610
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C1M55_12610
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C1M55_12610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rqi01011]
    C1M55_12610
Enzymes [BR:rqi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C1M55_12610
Peptidoglycan biosynthesis and degradation proteins [BR:rqi01011]
 Precursor biosynthesis
  Amino acid ligase
   C1M55_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AUS31867
UniProt: A0A1X0LVH5
LinkDB All DBs
Position
1:2675845..2676951
Genome map
AA seq 368 aa AA seqDB search
MNSSRTRVAVIFGGRSNEHSVSCVSAGSVLSNLDPDRYDVVPIGITVDGSWVLGSSDPSS
LAISGRALPSVDKDGTSVVLSADPTREGEVISFDGSDAGAVLASVDVVFPVLHGAYGEDG
TIQGLLELAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPVGVQVVLRPGTATLTEEQKA
ELGLPVFVKPARGGSSIGITRVSNWDGLDGAIAHARLHDPKVIVEGAIIGREVECGVLEF
PNGDVKASVVAEIRMPDSDADSDAFYDFDTKYLDDVCEFDIPAKLDESVSDQIRELAVRA
FKALDCQGLSRVDFFVTADGPVINEINTMPGFTSISMYPKMWNATGIDYRTLISTLVDTA
VARGTGLR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcagccgtacccgcgtggccgtgatcttcggtggccggagcaatgagcattca
gtgtcctgtgtttccgccggaagcgtcctgagcaacctcgaccccgatcggtacgacgtc
gtaccgatcggcatcaccgtcgacggttcctgggtgctcggttcgagcgaccccagttcc
ctcgcgatcagcgggcgcgcgctgccgtcggtcgacaaagacggaacgtcggtggtcctc
agcgcggaccccacccgcgagggcgaggtcatctccttcgacggctccgacgccggtgct
gtgctcgcgtcggtcgacgtcgtgttccccgttcttcatggggcttacggcgaagacggc
acgattcagggtctgctcgaacttgccggggttccgtacgtcggacccggagttctggcc
agcgccgccggcatggacaaagagttcacgaagaagcttcttgctgctgaaggacttccc
gttggagtgcaggtcgtgcttcggccgggaaccgcaacgctgaccgaagagcagaaggcg
gaattgggccttccggttttcgtcaagcccgctcgtggaggctcgtccatcggcatcact
cgggtgagcaattgggacggtctggacggggcgatcgctcatgcacgcctgcatgacccc
aaggtgatcgtcgaaggcgcgatcatcggccgcgaggtggaatgcggcgtcctcgaattc
ccgaacggcgacgtcaaggcgagtgtggtcgccgagatccggatgccggattccgacgcc
gattcggacgcgttctacgacttcgacaccaagtacctcgacgacgtctgtgaattcgac
atccccgcgaaactcgacgagtcggtgagcgaccagattagggagcttgctgtccgcgcg
ttcaaggcactcgattgccagggactctcgcgggtcgatttcttcgtcacggctgacggc
ccggtgatcaacgagatcaacacgatgcccgggttcacttccatctcgatgtacccgaag
atgtggaacgccaccggaatcgattaccgcactttgatttcgactctggtcgacaccgcc
gtcgctcgcggcacgggccttcgctga

DBGET integrated database retrieval system