KEGG   Rhodococcus qingshengii: C1M55_17420Help
Entry
C1M55_17420       CDS       T05315                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi00250  Alanine, aspartate and glutamate metabolism
rqi00410  beta-Alanine metabolism
rqi00430  Taurine and hypotaurine metabolism
rqi00650  Butanoate metabolism
rqi01100  Metabolic pathways
rqi01110  Biosynthesis of secondary metabolites
rqi01120  Microbial metabolism in diverse environments
rqi02024  Quorum sensing
Module
rqi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C1M55_17420
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C1M55_17420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1M55_17420
   00430 Taurine and hypotaurine metabolism
    C1M55_17420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C1M55_17420
Enzymes [BR:rqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C1M55_17420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUS32709
LinkDB All DBs
Position
1:3764084..3765475
Genome map
AA seq 463 aa AA seqDB search
MPEPRRSDHTDYVAVNPIFSRPGEDSVASKYTLEPDGMLPETAYQIVHDETMLDGNARLN
LATFVSTWMDDHATKLYAESFDKNMIDKDEYPQTAAIETYCWRILADLWHSPSPKDAIGT
STIGSSEACMLGGLAMKRRWQHARKAAGKSTEKPNLIMSSAVQVCWEKFCNYWDVEARYV
PISEEHRTLDGHDLDKYVDENTIGVVAIMGVTYTGMYEPVLEISKALDEIQAKTGLDVPI
HVDGASGAMIAPFLQPELEWDFRLPRVHSINTSAHKYGLVYPGLGWVVWRSQDLLPDDLV
FKVSYLGGSMPTFALNFSRPGAQVILQFYLFLRLGHDGYRAIQQSSQDVAKFLAEGIGKL
DAFELWNDGSDIPVFAWRLAEGHTSNWTLYDLSDRLRGKGWLVPAYPMPDDLADLTVQRI
VVRNGLSMDLAANLLRIIEEETAFLDELDSPMPRPRVTEGFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacccagaaggtcagatcacaccgattacgtagccgtcaatccgatcttctcg
aggcctggcgaggattcggttgcatcgaagtacacactcgaacccgatggcatgcttccc
gagaccgcgtatcagatcgtccacgacgaaacgatgctcgacggcaatgcgcggctcaat
ctcgcgacgttcgtcagcacgtggatggacgatcacgccaccaaactgtatgccgagtcg
ttcgacaagaacatgatcgacaaggacgagtatccgcagaccgccgcgatcgaaacctat
tgctggcgcatccttgccgatctctggcactcaccctcccccaaggacgcaatcggcacc
tcgacgatcggttcgtccgaagcctgcatgctcggcggcctggcgatgaaacgacgctgg
cagcacgcacgaaaagccgcgggcaagtcgaccgaaaagccaaatctcatcatgagttcc
gcggtccaggtgtgctgggagaagttctgcaactactgggacgtcgaagcgcgttacgtg
ccgatcagcgaggaacaccgcaccctcgacggtcacgatctggacaagtacgtcgacgag
aacaccatcggcgtcgtcgcgatcatgggcgtcacctacaccgggatgtacgagccggtc
ctggaaatctcgaaggcactcgatgagatccaggcgaagacgggactcgacgtccccatc
cacgtcgacggcgcttccggtgcgatgatcgcaccgttccttcagcccgaactcgaatgg
gatttccgactaccgcgcgtccactccatcaacacctcggcgcacaagtacgggctcgtc
tatcccggcctcggatgggtggtctggcgatcgcaggatctacttcccgacgacctcgtc
ttcaaggtgagctacctcggcggcagtatgccgaccttcgcactgaacttctcgcgcccc
ggcgctcaggtgatcctgcagttctacttgttcctgcgtctcggccacgacggctatcgc
gcaatccagcagtcctcccaggacgtggcgaaatttctcgccgaagggatcgggaaactc
gacgcgttcgaactgtggaacgacggttccgacatcccggtcttcgcgtggcgcctcgcc
gaggggcacacgtccaactggacgctgtacgacctctcggaccggttgcgaggcaagggc
tggttggtgccggcctaccccatgccggacgatctcgcggatctgacagtgcagcgcatc
gtggttcgtaacggactgagcatggacctggcggccaatctgctgcgcatcatcgaagag
gaaaccgcgttcctcgacgaactggacagcccgatgccgcggccgcgcgtcaccgaggga
ttccatcactga

DBGET integrated database retrieval system