KEGG   Rhodococcus qingshengii: C1M55_22740Help
Entry
C1M55_22740       CDS       T05315                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    C1M55_22740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rqi03400]
    C1M55_22740
Enzymes [BR:rqi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C1M55_22740
DNA repair and recombination proteins [BR:rqi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C1M55_22740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AUS33634
LinkDB All DBs
Position
1:complement(4883968..4886250)
Genome map
AA seq 760 aa AA seqDB search
MATTDRGQITLDGTTVSVTNLGKILYPESGTTKAEVIDYYTRIAAVMLPHVVGRPGTRKR
WPNGVDGQSFFEKNLASSAPQWLTRASLQHSDRVVTYPVFDSVASLAWLGQQAALELHVP
QWRFDGSERGPATRLVFDLDPGEGVGLTECAEVARSIRDLVATLGWTAYPVTSGSKGIHL
YVPLDRALDGSGASTVAKQIATGLEKLHPDLVTATMARNVRAGKIFVDWSQNNAAKTTIA
PYSMRGRDQPYVAAPRSWDELDDPKLRHLLFDEVLERVESDGDLLGDLDPPVSAAVADTL
THYRNKRSADRTPEPIPAAVTKETAGNTFVIQEHHARRLHYDVRLERDGVLVSWAVPKGV
PTSAGENRLAVHTEDHPLEYATFSGTIPKGEYGGGSMTIWDSGTYETEKWREDEVIVRLS
GKRVQGRFALIRTKGDQWLMHLMKDQNASFGTEFPKNLEPMLATAGTLEGLDSQEWAFEG
KWDGIRVILEYHSGTMSLRSRAGNDKTGDYPALAGLAEVLDGHDVVLDGEVVAYNDAGVT
DFGLLQRGGEPVFLAFDLLYLDGVSLLRKSYSDRRTVLNALAGKVGELEVPPQIEGTAEN
ALEVSTDAGWEGIVAKRRASVYLPGRRGSSWIKVKNWRTQEVVIGGWRTGQGNRAQGIGA
LLMGIPGEDGLTYVGRVGTGFSDRDLESLLATLEPLRQKESPFGEELPADDRKGAVWVKP
ELVGEVRFMDWTATGRLRHPSWRGLREDKKPGDVVRETVQ
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacggatcggggtcagatcacgctcgacggcacaacggtgtccgtgaccaat
ctgggcaagatcctctaccccgagagcggcaccacgaaggccgaagtcatcgactactac
acccgtatcgccgcagtcatgcttccgcatgtcgtcggtagaccgggcactcgtaagcgt
tggcccaatggcgtggacggtcagtccttcttcgagaagaaccttgcgtcgtctgccccg
cagtggctcacgcgtgcgtcgctgcaacattctgatcgtgtcgtcacttacccggtcttc
gattccgttgcatccctggcgtggctggggcagcaggccgcactcgaattgcacgttccc
caatggcgattcgacggttccgagcgtggtccggcgacacgactggtattcgatctcgac
ccgggcgaaggcgtcggattgaccgagtgcgccgaggtggcgaggtcgattcgagatctg
gtcgcaactctggggtggactgcctatccggtaaccagtggtagcaagggaattcacctc
tacgttccactggatcgagccttggacggcagcggtgcgtcgactgtcgccaagcagatc
gccaccggactcgagaagcttcacccggatctcgtcaccgcgacgatggctcgaaatgtg
cgggcaggcaagattttcgtggactggagtcagaacaacgcagccaagacaaccattgcg
ccgtactcgatgcgtggtcgcgatcaaccctatgttgccgcgccgcgcagttgggacgaa
ctcgacgatccgaaactacggcatctgttgttcgacgaggttctggagcgcgtcgaatcc
gatggtgatctgctgggcgatctggatccgccggtctcggcggctgtagccgacacgttg
acgcactatcgcaacaagcggtcggccgaccggacgccggagccgatccctgctgcggtg
accaaggagacagcgggcaatacctttgtgattcaggaacatcacgccagacgattgcat
tacgacgttcggctggagcgggatggtgtgctcgtgtcctgggctgttccgaagggcgta
ccgaccagtgccggagagaatcggttggccgtgcacaccgaggatcacccgctcgagtac
gccacgttctcgggcacgattccgaagggggagtacggcggcggttcgatgacgatctgg
gattccgggacgtacgagaccgagaagtggcgtgaagacgaggtgatcgtgcgcctcagt
gggaaacgggtgcagggacgcttcgcgctgatccggacgaagggtgaccagtggttgatg
catctgatgaaggatcagaacgcgagtttcggaacggagtttcccaagaatctcgagccg
atgcttgccaccgctggaacgctcgaaggtctcgactcgcaggagtgggctttcgaaggt
aagtgggacgggattcgagtgattctcgaatatcattcgggcacaatgtcacttcgcagt
cgcgcgggtaacgacaagaccggggactatcccgcccttgccgggttggccgaggtgctg
gacggtcatgacgtggttctcgacggggaagtggtggcgtacaacgacgcgggggtcacc
gatttcggtcttctccagcgaggtggggagccggtgttcctggccttcgatcttctgtac
ctcgacggagtgtctttgctgcggaaatcctactcggaccggcgcaccgtgttgaatgcg
ttggcgggcaaggtcggtgagctcgaggtacctccacagatcgagggcacggcggagaac
gcgttggaggtgagtaccgatgccggatgggaagggattgtcgccaaacgtcgtgcatcg
gtctaccttccggggcggcgtgggtcgagttggatcaaggtgaagaactggcgcactcaa
gaggtggtgatcggagggtggcgcactgggcagggcaatcgagcacaggggatcggggcg
ctgctcatgggaattccgggtgaggatggattgacctacgtggggcgcgtcggtaccggc
ttcagtgatcgcgacttggagtctttacttgcgacactggaaccgctgcgtcagaaggaa
agtccgtttggggaggaactgcccgccgacgaccgcaagggagcagtgtgggtgaaaccg
gaactcgtcggtgaggtgcggttcatggattggacggcgaccggacgccttcgtcatccg
agttggcggggtctgcgggaggacaagaaaccgggcgacgtggtgcgggaaacagtgcaa
tga

DBGET integrated database retrieval system