KEGG   Rhodococcus qingshengii: C1M55_25180Help
Entry
C1M55_25180       CDS       T05315                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rqi  Rhodococcus qingshengii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AUS34064
LinkDB All DBs
Position
1:complement(5365595..5366641)
Genome map
AA seq 348 aa AA seqDB search
MELPLMPPLAPMLAKAAATVPPQPESGDPTWSYEPKWDGFRAIIFRDGDEVVLGSRGGKD
LARYFPEAVEAVKSELPEKCVVDGELVVPREIDGVTRLSWEALSERIHPAASRVALLSEQ
TPAQFVGFDLLALGDRDVSIEDFGVRRALLLDCVGGGPSCHVTAATADSAEAMAWFETFE
GAGLDGVVAKKLAGPYLPNKREMIKVKHARTADVVLLGYRPHKSQPGIGSMLLGLYDGSE
LKMVGGASAFTAARRIELLAELEPLRLGDDVVAEGEASRWRSAADRSWIPLRPERVLEVA
YDQMEGERFRHAARFLRWRPDRVPGECTFDQLEVPVRYDFADVLAGGK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggagctacccctgatgccgccgcttgccccgatgctcgcgaaggctgcggccactgtg
ccgcctcagcccgagtccggtgacccgacgtggtcgtacgagccgaaatgggacggattt
cgagcaatcatctttcgtgacggtgacgaagtggtgctcggatcgcgaggaggaaaggac
ttggcgcggtactttcccgaggcggtggaagccgtcaagtctgaattgcccgaaaaatgt
gtggtggacggagaactggtggttccccgtgagatcgacggtgtgacgcgcctgagttgg
gaagcgctctccgagcggattcaccccgccgcgagccgcgtcgcattgttgtcggaacag
acgcccgcgcaatttgtcgggttcgatttactggcgctcggggatcgcgacgtctcgatc
gaggacttcggggttcgacgtgcgttgctcctcgattgcgtcggtggcgggccgagttgc
cacgtcacggcagcgacggccgacagcgccgaagcaatggcctggttcgaaaccttcgaa
ggcgcgggtctcgacggggttgtcgccaagaagctggcgggaccgtacctgccgaacaag
cgcgagatgatcaaggtgaaacacgccaggaccgcggatgtcgtactgctgggctaccgt
ccccacaagagtcagccaggtatcgggtcgatgcttcttggtctgtacgacggttccgaa
ttgaagatggtcggtggcgcttctgctttcaccgcggcgcggcggatcgagttgttggcc
gaactcgaacctttgcgcctcggggacgacgttgtagccgagggagaggccagccggtgg
agatcggccgcagaccgctcctggattccgcttcgtcctgagagggtgctcgaagtggcg
tacgaccagatggaaggggaacgctttcggcacgctgcacgattcctgcgctggcgtccg
gacagggtgcccggcgaatgcacattcgatcagttggaggttccggtgcgatacgacttc
gcggatgttcttgcaggcggtaagtga

DBGET integrated database retrieval system