KEGG   Rickettsia rickettsii Arizona: RPO_00975Help
Entry
RPO_00975         CDS       T01721                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rra  Rickettsia rickettsii Arizona
Pathway
rra00020  Citrate cycle (TCA cycle)
rra00190  Oxidative phosphorylation
rra00650  Butanoate metabolism
rra01100  Metabolic pathways
rra01110  Biosynthesis of secondary metabolites
rra01120  Microbial metabolism in diverse environments
rra01130  Biosynthesis of antibiotics
rra01200  Carbon metabolism
Module
rra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPO_00975 (sdhA)
   00650 Butanoate metabolism
    RPO_00975 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPO_00975 (sdhA)
Enzymes [BR:rra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RPO_00975 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RPO_00975 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFB24458
LinkDB All DBs
Position
171018..172808
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIVHHKFDVVVVGAGGAGLRSAFGMAKAGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAALPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSSEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYYGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRTQ
ELLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDEDWMKHTLSSIDEAGKVVLDYKPVTLTTLTDEVTAVPPVKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcgttcatcataaatttgacgtagtagttgtaggtgcaggc
ggagcaggtcttcgttctgcattcggtatggctaaagcagggctaaatactgcttgtata
actaagctgttcccaacccgtagtcatactgtggctgctcagggcggaattagtgcggct
cttgggaatatgggtgaagatgattggcgttggcatatgtacgatacggtaaaaggttct
gattggttaggcgatcaggatgccattgagtatatgtgcaaaaacgctcccgatgcgatt
ttagagctagagcattacggcgtacctttctcaagaactgaagagggaaaaatttatcag
cgtccttttggagggatgacaacagagtacggcaaaggaaaagcagctcagcgtacatgt
gctgcggcagatcgtacggggcatgccatactgcatactttatatcaacagtcactaaaa
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtagaggcgtagttgcgtggaatttagatgacggtagtctgcattgttttagagcgcat
aatgtagtgcttgcaacgggcggatacgggcgtgcttatttttcagcgacgtctgctcat
acttgtactggtgatgggggcggtatggcgattagagccgctcttccactgcaagatatg
gaatttgtacagttccatccgacaggtatatattcggccggctgtcttattaccgagggg
gcaagaggtgaagggggatatctcgttaatgcaaacggtgagcgttttatggagcgttat
gctcctgctgcaaaggatttagcttcaagagatgtagtttcaagagcaatgactatagaa
ataagagaggggcgaggagtcggcgagcataaagatcatgtatttttacatttaaatcat
ttatcgtctgagattttacatagtcgtttgcccggtatctctgagacggctaaaattttt
gccggtgttgacgtgactaaagagccgataccggtacttcctacggtacattataatatg
ggcgggataccgacgaattattacggtcaagtcataatcaaagacggtaaaaatcataat
agcgtagtaaaagggcttatggcaatcggtgaagcggcttgcgtatcggtacacggtgct
aaccgattaggatcaaattctttgcttgatttggtagtatttggtagaagttctgcatta
aaagcagccgagcttattaagcctgcgagtccccacaagtctataaaagaagaaagcctt
gaaaaaattataaatagatttgataaagtccgtcacgctaacggtaatattttagttgca
gagttaaggcttaaaatgcaaagaactatgcaaagccatgcttcggtatttagaactcaa
gagctactagatgaaggggcaggaatgattagcgaaataagaagcggctataaagatata
aaaattaacgataaatctttaatttggaatagcgatttggtggaagccttagagctagat
aatctacttgatcaagctttagtaacggtatattcggcagctgcaagaaaagaaagcaga
ggagctcatgcacgtgaagattatcctgatcgtaatgatgaggattggatgaagcatact
cttagctctatcgatgaagcaggtaaagtagttcttgattataaacctgtgactttaact
actttaaccgatgaagtaacagcagtcccgccggtgaagagagtgtactga

DBGET integrated database retrieval system