KEGG   Rickettsia rickettsii Brazil: RPN_04120Help
Entry
RPN_04120         CDS       T01737                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
rrb00061  Fatty acid biosynthesis
rrb00780  Biotin metabolism
rrb01100  Metabolic pathways
rrb01130  Biosynthesis of antibiotics
rrb01212  Fatty acid metabolism
Module
rrb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rrb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPN_04120
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RPN_04120
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RPN_04120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rrb01004]
    RPN_04120
Enzymes [BR:rrb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RPN_04120
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RPN_04120
Lipid biosynthesis proteins [BR:rrb01004]
 Fatty acid synthase
  Component type
   RPN_04120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AFB22324
LinkDB All DBs
Position
677046..677828
Genome map
AA seq 260 aa AA seqDB search
MTTGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSGVLEKRVKPLAEEIGCN
FVSELDVTKPKSISNLFDDIQEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHI
SCYSLLELSRSAEALMHNGGSIVTLTYYGAEKVIPNYNVMGVAKAALEASIKYLANDMGE
NNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKG
VTGEIHYVDCGYNIMGSNKL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactacaggattactacaaggaaaaaaaggcttaattacaggtattgcaaataatatg
tcaatatcgtgggcgattgcacagcttgctaaaaaacacggagcagagctatggtttact
tatcaatcgggagtactagaaaaacgagttaaaccactcgctgaggaaataggttgtaat
tttgttagcgaacttgatgttacgaagccaaaatcaattagtaatttatttgatgatata
caagagaaatggggtagcttcgatttcttacttcacggtatggcttttgccgataaaaat
gaattaaaaggacgttatgttgatactagcttagaaaattttcataattctttacatata
tcatgttactctcttttagaactctcaaggtccgcagaagccttaatgcataacggcgga
agcattgtgacattaacttactacggcgctgaaaaagttatacctaattataacgttatg
ggagtcgccaaagctgcacttgaggctagtataaaatatttagcaaacgatatgggagaa
aataatattagggtaaatgctatttcggcaggacctatcaaaactttagcatctagtgca
ataggtgattttagtactatgcttaaatctcacgctgcaactgcaccgttaaaacgtaat
actacccaagaagatgtaggaggagcagcagtatatttatttagtgaattatctaaaggt
gttaccggtgaaatccattatgtagattgcggttataatattatgggaagtaataaatta
taa

DBGET integrated database retrieval system