KEGG   Rickettsia rickettsii Colombia: RPL_00735Help
Entry
RPL_00735         CDS       T01722                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00473  D-Alanine metabolism
rrc01100  Metabolic pathways
rrc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rrc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RPL_00735 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RPL_00735 (alr)
Enzymes [BR:rrc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RPL_00735 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rrc01011]
 Precursor biosynthesis
  Racemase
   RPL_00735 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFB23066
LinkDB All DBs
Position
126105..127172
Genome map
AA seq 355 aa AA seqDB search
MSLCTVEINLSTIKNNYLLLQDVCKTSLVGAAVKANGYGLGAIQISKALIEENCRHFFVA
SSEEGVNLRNALGLDINILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRL
LPCYLHFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNR
FKAYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLNPLTKNPVTLKAPIIHLQN
LTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSNQGEVFINSRSVPIVGRVSMDLI
NIDVTDLPPSEIFLGQEAEIIGNYCTPNKIASIIGTIGYEVLTNLGSRYKRKYIG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtgtactgtagaaataaatctatctacaataaaaaataattaccttttatta
caagatgtttgcaaaacctcattagtcggtgctgccgttaaagctaacggttacggtctt
ggagcaatacaaatttctaaagctttaatagaagaaaattgtaggcatttttttgtggcc
tcaagtgaagaaggagtgaatttacgcaacgctttaggattagatattaatattttagtt
cttaacggcgtttttgaacatgatgctttagagctgatagaatataatttaacacctgtc
ctaaataacttaaaacaaatagaaatttggcaaaaatttagtaatttgaaaaaccgatta
ttgccttgttatttacatttcaatacggggattaatcgtcttggcttaagctctgatgag
atagagcagctcattaatgatcgtgatttgttaaaagggctagatttacaatatattata
agccatctagctatatccgaggaaatagataatccttataatctagaacaattaaacaga
tttaaagcttatttacaatatttcccaaacgtcaaagcaagccttgctaattccggcggc
atatttttaggacaggattaccattttgatttagcaagaccaggggcagccttatatggt
cttaatcccttaacaaagaatcccgtaaccttaaaagctcctataattcacttacagaat
ttgacactagatagccatatcggttataatatgacttttacaactaagcgtgatagtgtc
attgcaacgttaccgcttggttatgctgatgggtttagtcgtaattttagcaatcaaggc
gaagtatttattaacagtcgcagcgttcctatagtagggcgagtatcgatggatttaata
aatatcgatgttaccgatctaccaccatccgagatttttctagggcaggaagcggaaatt
atcggaaattattgcacgcccaataaaatagcgagtattataggtactatcgggtatgag
gtattaactaaccttggtagtagatataaaagaaagtatatcgggtag

DBGET integrated database retrieval system