KEGG   Rubrobacter radiotolerans: RradSPS_0023
Entry
RradSPS_0023      CDS       T03080                                 

Definition
(GenBank) Protein kinase domain
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rrd  Rubrobacter radiotolerans
Brite
KEGG Orthology (KO) [BR:rrd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rrd01001]
    RradSPS_0023
Enzymes [BR:rrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RradSPS_0023
Protein kinases [BR:rrd01001]
 Serine/threonine kinases: Other
  Bacterial family
   RradSPS_0023
SSDB
Motif
Pfam: Pkinase PASTA PK_Tyr_Ser-Thr APH Kdo Kinase-like Pkinase_fungal RIO1
Other DBs
NCBI-ProteinID: AHY45306
UniProt: A0A023WZB0
LinkDB
Position
complement(24249..26522)
AA seq 757 aa
MEQLVDNRYEIVKPLGSGGMADVFLAHDSVLDRSVALKVMNSRYARDEEFVERFRREAQS
AAALSHPNIVSIYDRGGSEDGTYYIAMEYLPGGTLKDRVLKKGALPPKTAAEVAKQIAEA
LRAAHDRGVVHRDIKPHNILITEAGDIKVTDFGIARAASSSTMTKTGAVMGTAHYISPEQ
AMGESVGPASDLYSLGVVLYEMLTGELPFDADTPIGIAMKHVNGTPPPPKEINPAVPAGL
NAIVVRLLQKDPANRYASDTELIEDLERVAQGESPTSAAATQVMEKLERTGEFAPAAVPP
TDRMPRTQREAPKNGRGRRLAPLLLVVLLLALLGVGGAMMLGNLLGGPSTNNDPNAAQVE
VPDLTGLTLQEARQEVGDSFEISEADTQNSPEQEGTIIEQDPASGGTLAEGSEIEVTTAS
GTNAVPDVVNEQRQQAVRQVEDAGFEVRIQERESEENEAGQVLSQNPGGGSNQEVGSRVT
LTVGAGVDTVTVPDIPYGSTEAQSRSILEDANLTLGSVTTEASAEIEEGTIISQNPLAGE
EVEQGSAVDIVLSSGPEQVTVPDVVGDDLDSALATLQGLGLGYTPVGVESSEPEGTVIST
DPAGGTTIDLDQDAIVTVTYSLGQASPVVPEQPSPSPSPPPSSGGNDSGSASPGGGNDSD
NNSGSGGGSGGGSDSGSGGGSGGGSGSGSGGGSGSGSGGGSGGNNAGGGGSGGGGGQSPV
QRAPRSGGDRGQSGSGGDPVIPEESQEAIEELRSAVG
NT seq 2274 nt   +upstreamnt  +downstreamnt
gtggagcaactagtagacaaccgctacgagatcgtaaagcctctcggcagcggcggcatg
gccgacgtctttcttgctcacgacagcgttctcgaccgcagcgtcgcgctcaaggtcatg
aactcgcgctacgcccgcgacgaggagttcgtcgagcgcttccggcgcgaggcccagagc
gccgccgcgctctcccacccgaacatcgtttcgatctacgaccggggcggctccgaggac
gggacctactacatcgcgatggagtacctccccggcggcaccctgaaggaccgggtgctc
aagaagggcgcgctcccgccaaagacggccgcggaggtcgcaaagcagatcgccgaggcc
cttcgcgcggcccacgaccggggcgtcgttcaccgggacataaagccgcacaacattctt
ataaccgaggccggggacataaaggtcacggacttcggtatcgcccgggcggcctcctcc
tcgacgatgacaaagaccggcgcggtgatggggacggctcactacatctcccccgagcag
gcgatgggcgagtcggtgggtccggcgagcgacctctactccctgggcgtcgttctatac
gagatgctcaccggcgagctgccgttcgatgcggacaccccgataggcatcgccatgaag
cacgtaaacgggaccccgccgccgccgaaggagatcaacccggccgtcccggcgggtctg
aacgcgatcgtcgttcgcctgctccagaaagaccccgccaaccgctacgcttcggacacc
gagcttatcgaggatctggagcgcgtagctcagggcgagtccccgacgagcgcggcggcg
acgcaggtgatggagaagctcgaaaggacgggggagttcgctccggccgccgtcccgccg
acggaccggatgccccggacgcagcgggaggccccgaagaacggtcggggacggaggctc
gcgccgctgctgctcgtggtcctgctcctcgcgctgctcggcgtcggcggggcgatgatg
ctcgggaaccttctgggcggcccgagcacgaacaacgatccgaacgccgcgcaggtcgag
gttccggacctcaccgggctcacgctgcaggaggcccggcaagaggtcggtgacagcttc
gagatctccgaggcggacacgcagaacagcccggagcaggaggggacgataatcgagcag
gaccctgcaagcggcggtacgctcgccgagggctccgagatcgaggtaacgaccgcgagc
ggcacgaacgccgtcccggacgtcgtgaacgaacagcgccagcaggccgtccggcaggta
gaggacgcaggcttcgaggtccgcatccaggagcgtgagagcgaggagaacgaggccggt
caggtcctctcgcagaaccccggtggcggctcgaaccaggaggtcggctccagggtaacc
ctgaccgtcggggccggggtagataccgtgaccgttccggacatcccctacggcagcacc
gaggcccagagccgctccatcctcgaagacgcgaacctgacgctcggcagcgtaacgacc
gaggcgagcgccgagatcgaggagggcacgatcatctcccagaacccgctcgcaggcgag
gaggtcgagcagggctccgcagtggacatcgtccttagctccggtcccgagcaggtcacc
gtcccggacgtcgtgggcgacgacctcgacagcgcgctcgcgacgctccaggggctcggg
ctcggctacacacccgtcggagtcgagagcagcgagcccgagggaacggttatctcgacc
gacccggccggcgggaccacgatagacctcgaccaggacgccatcgtcaccgttacctac
agcctcggccaggccagcccggtcgtcccggagcagccctcgccatctccgagcccccct
cctagcagcggcggcaacgatagcggcagcgcctccccgggcggcggcaacgatagcgac
aacaacagcggctcaggcgggggttccggtggaggctccgacagcggctctggcggaggt
tccggtggaggctccggcagcggctcgggagggggttccggcagcggctcgggcggaggt
tccggcggcaacaacgccggaggcggcggctctggcggcggaggcggacagagcccggtc
cagagggctccccggagcggcggggacagggggcagtccggaagcgggggcgacccggtt
atcccggaggagagccaggaggcaatagaagagttgaggtcggccgtcggctga

DBGET integrated database retrieval system