KEGG   Rubrobacter radiotolerans: RradSPS_0718Help
Entry
RradSPS_0718      CDS       T03080                                 

Definition
(GenBank) gatA: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rrd  Rubrobacter radiotolerans
Pathway
rrd00970  Aminoacyl-tRNA biosynthesis
rrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RradSPS_0718
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rrd03029]
    RradSPS_0718
Enzymes [BR:rrd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RradSPS_0718
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RradSPS_0718
Mitochondrial biogenesis [BR:rrd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RradSPS_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHY46001
UniProt: A0A023X1C8
LinkDB All DBs
Position
760360..761856
Genome map
AA seq 498 aa AA seqDB search
MGAANRLLDLSAYELAGKIRDREVSATEAAEVANRRIESVEDEVKSFITVTPEVALERAR
RIDERLADGGEVALHEGVPLVVKDVLSTKGTRTTCGSRMLEEFVPVYDATALARFSEDLV
MVGKANMDEFAMGSSTENSAYFPTRNPWALDRVPGGSSGGSAAAVAAGEGWWALGTDTGG
SVRQPAAFCGTVGLKPTYGRVSRYGLIAFASSLDQIGPMTRDVRDSALLLQAIAGHDRRD
STSARQPVPDYVAALEEGVSGLRVGVVTELTGAEGVEPEVREVSERTVRDLEAAGASVGE
VSLPHATYGLPAYYIIAPAELSSNLARFDGVRYGLRVPAEGVHEMYRRTREEGFGDEAKR
RIMLGTYALSSGYYDAYYAQAQKVRTRIIEDFRAAFSEYDVLVTPTCPTPAFGIGEKVDD
PLAMYANDICAVPASLAGIPAISIPGGTVDGLPVGVQLMADHFEESKLLRAARAAERASE
FRFQIKPDGAQNGTGAGS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcagcaaacaggcttctcgacctctccgcctacgagcttgccggaaagataagg
gaccgggaggtctccgcgaccgaggctgcggaggtcgccaaccggcgcatcgagtccgtc
gaggacgaggtaaagtcctttatcaccgtgaccccggaggtcgcgctagagagggctcgt
cgaatagacgaacggctcgcggacggcggggaggtagcgcttcacgagggcgtcccgctc
gtcgtgaaggacgtgctctcgacgaaggggacgcgcaccacctgcggctccaggatgctc
gaagagttcgtccccgtctacgacgcgacggcgctcgcgcggttctcggaggacctggtg
atggtcgggaaggcgaacatggacgagttcgcgatgggctcctcgacggagaactcggcg
tacttcccgacccgcaatccctgggctctcgaccgggtgccgggcggctcctcgggcggg
tcggcggcggcggtcgcggccggggagggctggtgggctctcgggacggacacgggcggt
tcggtcaggcagcccgccgcgttctgcgggacggtcgggctgaagccgacctacggacgg
gtttcgaggtacgggcttatagccttcgcctcatctctggaccagatcggcccgatgacc
cgcgacgtgcgcgactcggcgctccttcttcaggcgatcgccgggcacgaccgccgcgac
tcgacgagcgcgaggcagcccgtcccggactacgtggcggcgctcgaagaaggggtctcg
ggcctgcgggtcggggtcgtcacggagcttacgggcgcggagggcgtcgagcctgaggta
agggaggtctccgagcgtaccgttcgggacctcgaagcggccggggcttcggtcggggag
gtgagccttccgcacgcgacctacggcctcccggcgtactacatcatcgccccggcggag
ctttcctcgaacctcgcccgcttcgacggcgtgaggtacgggcttcgcgtcccggccgag
ggcgtgcacgagatgtaccggaggacgcgcgaggagggtttcggcgacgaggcgaagcgg
cgcatcatgctcgggacgtacgcgctgtcgagtggctactacgacgcgtactacgcccag
gcccagaaggtaaggacaaggataatcgaggacttccgcgccgcgttctccgagtacgac
gtgctcgtaaccccgacgtgcccgaccccggcgttcgggatcggggagaaagtagacgac
ccgctcgcgatgtacgcaaacgatatctgcgccgtcccggcgagcctcgccgggataccg
gcgatctcgatcccgggcggcaccgtcgacggtcttccggtcggcgtgcagctcatggcc
gaccacttcgaggagtcgaagctcctgcgcgcggcccgcgcggccgagcgggcttctgag
ttccggttccagatcaagcctgacggcgcacagaacgggacgggggccgggtcgtga

DBGET integrated database retrieval system