KEGG   Rubrobacter radiotolerans: RradSPS_1903Help
Entry
RradSPS_1903      CDS       T03080                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
rrd  Rubrobacter radiotolerans
Pathway
rrd00340  Histidine metabolism
rrd01100  Metabolic pathways
rrd01110  Biosynthesis of secondary metabolites
rrd01230  Biosynthesis of amino acids
Module
rrd_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rrd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    RradSPS_1903
Enzymes [BR:rrd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     RradSPS_1903
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     RradSPS_1903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AHY47186
UniProt: A0A023X4Q3
LinkDB All DBs
Position
complement(1998898..1999548)
Genome map
AA seq 216 aa AA seqDB search
MSRAERGTGRIRFDGAGLVPVVMQDAETGEVLTLAYANREAVDRTLETGEAYFYSRSRGE
LWHKGATSGNTQKVVEVRIDCDGDTLLYRVEPQGPACHTGERSCFYQTLAGEGVGLLPRD
GREASFGATVERLAGVVAERRREMPEGSYTAHLFERGTERIAQKVGEEGVEVVIAALKDE
KLAEEAADLVYHLVVLLEERGLGLEAVAKVLRDRHG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggccgagcgggggaccgggcggataaggttcgacggggcggggctcgtcccg
gtggtgatgcaggacgccgagacaggcgaggtgctgacgctcgcctacgctaaccgggag
gccgtggaccgaaccctcgaaaccggcgaggcgtacttctactcgcgctcgcggggggag
ctctggcacaagggcgcgacgagcggcaacacgcagaaggtcgtcgaggtacgcatagac
tgcgacggtgacacgctcctctaccgggtcgagccgcagggacctgcgtgccacacgggg
gagaggtcgtgcttttaccagacgctcgccggggagggcgtcggtcttctcccgcgcgac
gggcgggaagcctccttcggggcgacggtcgagcggctcgccggagtggttgccgaaagg
cgccgggagatgcccgaggggtcgtacaccgcacacctcttcgagcgggggacggagcgg
atcgcccagaaggtcggggaggagggggtggaggtcgtgatcgccgcccttaaggacgag
aagctcgccgaggaggcggcggaccttgtctaccatctggtcgtccttctcgaagagcgc
gggctcgggctcgaagcggtggcgaaggttcttcgggaccggcatggctag

DBGET integrated database retrieval system