KEGG   Rubrobacter radiotolerans: RradSPS_2609Help
Entry
RradSPS_2609      CDS       T03080                                 

Definition
(GenBank) GMC oxidoreductase
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Organism
rrd  Rubrobacter radiotolerans
Brite
KEGG Orthology (KO) [BR:rrd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RradSPS_2609
Enzymes [BR:rrd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.400  2-methyl-1,2-propanediol dehydrogenase
     RradSPS_2609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 GMC_oxred_N FAD_binding_3 Pyr_redox_2 DAO Lycopene_cycl NAD_binding_8 Fer4_16 Thi4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AHY47892
UniProt: A0A023X5Y8
LinkDB All DBs
Position
2712424..2714082
Genome map
AA seq 552 aa AA seqDB search
MGRRSYDETDVLVIGSGPGGAGVTKKLAAAGMRVMCLEQGPWVKPAQHPHFHNEWEIEKN
RGWAYDPNVRQLPEDYPVSGFTTPYMMNNVGGSVLHYAGHWPRYKPADFRKGTEHGLEGT
IDWPITYEDLAPFYDENDAEYGISGMTGDPSYPPRNGLQRDPAVHPGKLGLRFARGAKEL
GWHWWPSDNAIITKGRNGRLPCNACGNCLSGCPRGSLGTPDYTHWPQAIKDGADLRPMAR
VEQINASNGKVTGATYIDRNTGNRREVRAKIVVLAANGIGSPRLLLMSAQNGHPDGLANS
NGLVGKYLMHHIFAFCDSWFEDPIEGFKGAFGAPLYCHEFYHTDTDRGFVNGLGMQVARS
FGSAYTSVGTHTGYTVPWGEDHRKFFNEHFAHHLMVFMFGEDLPVETNRVTLDPEVTDSD
GLPAAHVNWVPHENDIALSNFGIERIFEATEAVGATETNDTGVLNPPPGWHLMGTCRMGN
NPEDSVTNKYNQTWDVPNLFIVDGSSLTTGGAVNPTSTIGALAVRAGEYIKRNFDAIVSQ
KTTPSNEDAPDM
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagaaggagctacgacgagaccgatgtattggtcatcggctccggtccgggaggg
gcgggagtaaccaagaagctggccgcggccggcatgcgggtcatgtgtctggagcagggt
ccctgggtgaagcctgcacagcacccccacttccacaacgagtgggagatcgagaagaac
cgcggttgggcctacgaccccaacgtccgccagctcccggaggattacccggtaagcgga
ttcacgacgccgtacatgatgaacaacgtcggcggcagcgtccttcactacgcgggccac
tggccgcgctacaagcctgcagacttcaggaaggggaccgagcacggactcgaagggacc
atagactggccgatcacgtacgaggaccttgcccccttctacgacgagaacgacgcggag
tacgggatctccgggatgaccggcgacccctcgtacccgccccgaaacggcttgcagcgc
gaccccgccgtccatcccggcaagctgggactcaggttcgccagaggtgcaaaagagcta
ggctggcactggtggccgtcggacaacgcgatcatcaccaagggccgcaacggacgcctc
ccctgcaacgcctgcgggaactgcctctccggatgtccgcgcggatcgctcggcacgccc
gactacacgcactggccccaggcaatcaaagacggcgcggacctcaggccgatggctcgc
gtcgagcagatcaacgccagcaacggcaaggtgacaggcgcgacctacatagatcgcaac
acaggcaacaggcgcgaggtccgcgccaagatcgtggtgctggccgcgaacgggatcggc
tctcctcgtttgctcttgatgagtgcccagaacggccatcccgacggactggcgaacagc
aacgggctggtgggcaagtacctcatgcaccacatcttcgcgttctgcgactcatggttt
gaggacccgatcgagggattcaagggcgctttcggagcccccctatactgtcacgagttc
taccatacggacacggaccgcggcttcgtcaacggcctcggtatgcaggttgcccgctcc
ttcggctcggcttacacctctgtgggcacccacaccggctatacggtgccgtggggtgag
gaccaccgcaagttctttaacgagcacttcgctcaccatttgatggtgtttatgttcggg
gaggacctgcccgtggagacgaacagggttaccctggaccccgaagtcaccgactcggac
gggctcccggccgcgcacgtcaactgggtaccgcacgagaacgacatcgcgctctccaac
ttcgggatagagcgcatcttcgaggccaccgaggccgtcggggcgaccgagacgaacgac
accggggtcctgaacccgccgccgggctggcaccttatgggcacctgccggatgggcaac
aacccggaagactcggtgaccaacaagtacaaccagacctgggacgtcccgaatctgttt
atcgtcgacggaagctccctgaccaccggtggcgcggtgaacccgacgtccactatcggc
gccctggcggtgagagctggcgagtacatcaagcgcaacttcgacgccatcgtctctcag
aagacgacccccagcaacgaggacgctcccgatatgtag

DBGET integrated database retrieval system