KEGG   Rickettsia rhipicephali: MCC_01495Help
Entry
MCC_01495         CDS       T01786                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rre  Rickettsia rhipicephali
Pathway
rre00020  Citrate cycle (TCA cycle)
rre00190  Oxidative phosphorylation
rre00650  Butanoate metabolism
rre01100  Metabolic pathways
rre01110  Biosynthesis of secondary metabolites
rre01120  Microbial metabolism in diverse environments
rre01130  Biosynthesis of antibiotics
rre01200  Carbon metabolism
Module
rre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rre_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCC_01495 (sdhA)
   00650 Butanoate metabolism
    MCC_01495 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MCC_01495 (sdhA)
Enzymes [BR:rre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MCC_01495 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MCC_01495 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFC71952
LinkDB All DBs
Position
251515..253305
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHQFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKKAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CKGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPMQDM
EFVQFHPTGIYLAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKSINEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHAAVFRTQ
EVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDGDWMKHTLSSIDEAGKVVLDYKPVTLTTLTDEVTAVPPAKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcattcatcatcaatttgacgtagtagttgtaggtgcaggt
ggagcaggtcttcgttctgcattcggtatggctaaagaagggctaaataccgcttgtata
actaagctgttcccaacccgtagtcatactgtggctgctcagggcggaattagtgcggct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacggtaaaaggttct
gattggttaggcgatcaggatgccattgagtatatgtgcaaaaaagctccagatgcgatt
ttagagctagagcattacggcgtacctttctcaagaactgaagagggaaaaatttatcag
cgtccttttggaggaatgacaacagagtacggcaaaggaaaagcagctcagcgtacatgt
gctgcggcagatcgtacggggcatgccatacttcatactttatatcaacaatcactaaaa
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtaaaggcgtagttgcgtggaatttagatgacggtagtctgcattgttttagagctcat
aatgtagtgcttgcaacgggcggatacgggcgtgcttatttttcggcaacgtctgctcat
acttgtacgggtgatgggggtggcatggcgattagagccggtcttccaatgcaagatatg
gaatttgtacagttccatccgacaggtatatatttggcgggctgtcttattaccgagggg
gcaagaggcgaggggggatatctcgttaatgcaaacggtgagcgttttatggagcgttat
gctcctgctgcaaaggatttagcttcaagagatgtagtttcaagagcaatgactatagaa
atcagagaggggcgaggagtcggcgagcataaagatcatgtatttttacatttaaatcat
ttatcgcctgagattttacatagtcgtttgcccggtatctctgagacggctaaaattttt
gccggtgttgacgtgactaaagagccgataccggtacttcctacggtacattataatatg
ggcgggataccgacgaattatcacggtcaagtcataatcaaagacggtaaaaatcataat
agcgtagtaaaagggcttatggcaatcggtgaagcggcttgcgtatcggtacacggtgct
aaccgattaggatcaaattctttgcttgatttagtagtatttggtagaagttctgcatta
aaagcagccgagcttattaagcctgcgagtccccacaagtctataaacgaagaaagcctt
gaaaaaattataaatagatttgataaagtccgtcacgctaacggtaatattttagttgca
gagttaaggcttaaaatgcaaagaactatgcaaagccatgctgcggtatttagaactcaa
gaggtactagatgaaggagcaggaatgattagcgaaataagaagcggctataaagatata
aaaattaacgataaatctttaatttggaatagcgatttagtggaagccttagagctagat
aatctacttgatcaagctttagtaacggtatattcggcagctgcaagaaaagaaagcaga
ggagctcatgcacgtgaagattatcctgatcgtaatgatggggattggatgaagcatact
cttagctctatcgatgaagcaggtaaagtagttcttgattataaacctgtgactttaact
actttaaccgatgaagtaacagcagtcccgccggcgaagagagtgtactga

DBGET integrated database retrieval system