KEGG   Rhodospirillum rubrum F11: F11_03420Help
Entry
F11_03420         CDS       T02006                                 

Definition
(GenBank) cobalamin-5'-phosphate synthase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00860  Porphyrin and chlorophyll metabolism
rrf01100  Metabolic pathways
Module
rrf_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rrf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    F11_03420
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     F11_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: AEO47154
LinkDB All DBs
Position
791573..792358
Genome map
AA seq 261 aa AA seqDB search
MTDQTKPSWTADRGADLLGALFFLTRLPTPTTHTPPPFTRAVWAFPLAGALVGLIGALAV
GGAQALGLSPTLAALLGVSVMALVTGAMHEDAVADIADGFGGGRTRERVLEIMRDSRVGA
FGVTALVLVLALRVAALAALAGGPWAMAALVCAAGLGRGAAVLMLGLLPPARTDGLGASF
GRPQQASLAFALILCLVLAVVLLPGAAPAVALVGMVAPTLYLAWRAKVRIGGQTGDVAGA
AALIGETLALVGLSAMLGAAP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatcaaaccaagccttcgtggactgccgaccgtggtgccgatctgctcggcgcc
ttgttcttcctgacccgtttgccgacgccgacgacccataccccgccccccttcacccgg
gcggtctgggcctttccgctggccggcgccctggttgggttgatcggcgccctggcggtg
ggcggtgcccaagccctgggcctgtcgccgaccctggccgccctgctgggcgtcagcgtc
atggccctggtcaccggggccatgcacgaggacgccgtggccgatatcgccgatggcttc
ggcggtggacggacgcgcgagcgggtgcttgagatcatgcgcgacagccgggttggcgcc
tttggcgtcaccgccctggtgctggttttggcgctgcgcgtcgccgccctcgctgccctg
gccggcggaccctgggcgatggcggcgctggtctgtgccgccggcctggggcgcggcgcg
gcggtgctgatgctggggttgttaccgccggcgcgcaccgatggcctgggcgccagtttc
ggccggccccaacaggcgtctttggctttcgccctgatcttgtgcctggtgctggcggtg
gttttgttgcccggcgccgccccggccgtcgccctggtcggcatggtggcgccgaccctt
tatctggcttggcgggccaaggtgcggatcggagggcagaccggcgatgtggccggcgcc
gccgccctgatcggcgagaccctggccctggtcgggctgtcggcgatgctgggggcggcc
ccatga

DBGET integrated database retrieval system