KEGG   Rhodospirillum rubrum F11: F11_09060Help
Entry
F11_09060         CDS       T02006                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Brite
Enzymes [BR:rrf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     F11_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEO48278
LinkDB All DBs
Position
2053286..2053969
Genome map
AA seq 227 aa AA seqDB search
MAYIACEPAIGFPDDRESGDTNNLGEIDMAFELPPLPFAKEALEPHISAKTFEFHHGKHH
NAYVTTLNSLIKDTPLADKSLEDIITTVAGDAAKTPVFNNAAQVWNHTFFWNSLSPTGGG
QPTGAAKEAIDGAFGSLDAFKEQFKQAGVTQFGSGWAWLVVDGGKLSIAKTPNAELPLTK
GQTAVLTCDVWEHAYYLDYQNRRPDFLQTFLDHLVNWDFLAANLAKA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatatcgcctgcgaacccgccatcggttttcccgacgatcgggagagcggcgac
acaaacaatctaggagagatcgacatggctttcgaactgccgcccctgcccttcgccaag
gaggccctggagccgcatatttcagccaagactttcgaatttcatcatggcaagcatcat
aacgcctatgtcaccaccctcaattcgttgatcaaagatacccccctggccgataagtcg
cttgaggatatcattaccaccgtggccggcgacgccgccaagaccccggtcttcaacaat
gccgcccaggtgtggaaccacacgtttttctggaacagcctgtcgccgaccggcggcggc
cagccgaccggcgcggccaaagaggcgatcgacggcgccttcggctcgctcgacgccttc
aaggagcagttcaagcaggccggcgtcacccaattcggcagtggctgggcttggctggtg
gtggacggcggcaagctgtcgatcgccaagacgcccaatgccgaattgcccctgaccaag
ggccagaccgccgttctgacctgcgatgtctgggagcatgcctattatctggattaccag
aatcgccgccccgacttcctgcagaccttcctggatcacctcgtgaactgggacttcctg
gcggccaatctggccaaggcctga

DBGET integrated database retrieval system