KEGG   Rhodospirillum rubrum F11: F11_09655Help
Entry
F11_09655         CDS       T02006                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00010  Glycolysis / Gluconeogenesis
rrf00020  Citrate cycle (TCA cycle)
rrf00620  Pyruvate metabolism
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
rrf01200  Carbon metabolism
Module
rrf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rrf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_09655
   00020 Citrate cycle (TCA cycle)
    F11_09655
   00620 Pyruvate metabolism
    F11_09655
Enzymes [BR:rrf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     F11_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AEO48397
LinkDB All DBs
Position
complement(2176545..2177867)
Genome map
AA seq 440 aa AA seqDB search
MPIEILMPALSPTMEEGTLAKWLKKEGDPIAAGDVIAEIETDKATMEFEATDEGVLGKIL
VADGTAGIKVNQPIGILLEEGEDASALVQAAPAKAPDAPAKAAPEPAPVAAASQSDAAPA
PAAAAPKRAAGERLFASPLARRIAAAEGLDLGALQGSGPHGRIVRRDVEAALAAGTGKTA
EKAVAAPVAPAAPPQAVAAAAPKPVALPDAPHTKVANTSMRKIIARRLTESKQTVPHFYL
TVDCKIDALLDLRKSLNARAEKRGDGVKLSVNDLIIKAVALALRKVPAANASWSDEAIVL
WSDVDISVAVATPGGLITPIVRKADQKGLATISAEMKDLATRARDGKLKPEEFQGGGFSI
SNLGMYGIREFAAIINPPQGCILAVGAGEQRPVVEAGALAIATVMSCTLSVDHRVVDGAV
GAEFLSAFKILIEDPMAMML
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgagatcctgatgcccgcgctctctccaacgatggaggagggaaccctggcc
aagtggctgaagaaggagggcgatcccatcgccgccggcgatgtcatcgccgaaatcgaa
accgataaggcgacgatggaattcgaagccaccgacgagggcgttcttggcaagatcctg
gtcgccgacggcaccgccggcatcaaggtcaaccagccgatcggcattttgcttgaggaa
ggcgaggacgccagcgccctggtccaggccgctccggccaaagccccggatgccccggcc
aaggccgcgcccgagccggcccctgtcgccgcggcgtcccaaagcgacgccgcgcccgcc
ccggcggcggccgcgcccaagcgggcggccggtgaacggctgttcgccagtccgctggcc
cggcgcatcgccgccgccgaaggccttgatctgggagcccttcaaggcagcggcccccat
ggccgcatcgtgcgccgcgatgtcgaggcggctttggccgccggcaccggtaaaacggcc
gaaaaggcggttgccgcgccggtcgctcccgccgctccgccgcaagcggtcgccgccgcc
gcgcccaagcccgtggccttgcccgacgcgccccataccaaggtggccaatacgtcgatg
cgcaagatcatcgcccggcgcctgaccgagtccaagcagacggttccccatttctacctg
accgtcgattgcaagatcgacgccctgcttgatctgcgtaagagcttgaacgcccgggcc
gaaaagcgcggcgacggggtcaagctgtcggtcaacgacctgatcatcaaggccgtcgcc
ctcgccctgcgcaaggtgcccgccgccaacgcctcgtggagcgacgaggcgatcgtgctg
tggagcgatgtcgatatctcggttgccgtcgccaccccgggcgggttgatcaccccgatc
gtccgcaaggccgaccagaaggggctggcgacgatctcggccgagatgaaggatctggcg
acgcgggcccgcgacggcaagctcaagcccgaggagttccagggcggcggcttcagcatc
tccaaccttggcatgtacggcatccgcgagttcgccgcgatcatcaatccgccccagggc
tgcatcctggccgtcggcgccggcgaacaacgcccggtggtcgaggccggagccttggcg
atcgccacggtgatgagttgcacgctctcggttgaccatcgggtggtcgatggcgcggtc
ggcgccgaattccttagcgccttcaagatcttgatcgaagatcccatggcgatgatgctc
tag

DBGET integrated database retrieval system