KEGG   Rhodospirillum rubrum F11: F11_19135Help
Entry
F11_19135         CDS       T02006                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01130  Biosynthesis of antibiotics
rrf01230  Biosynthesis of amino acids
Module
rrf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rrf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F11_19135
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     F11_19135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 CoaE AAA AAA_18 TsaE AAA_22 Roc
Motif
Other DBs
NCBI-ProteinID: AEO50287
LinkDB All DBs
Position
4290807..4291373
Genome map
AA seq 188 aa AA seqDB search
MIEAEENTLALPRTLVLVGLMGAGKTCIGRRLAQMAGVPFVDADVEIERAAKRTIAEIFA
TYGESEFRALERRVMARLLAGRTCVLATGGGAFMAEDTRALIRLHGLSLWLRADLDLLVA
RTAGRTHRPLLNNGDAREKLAELMAKRHPVYAEADIVFDALDESQDASALRVRSCLLSYL
ADHAETAP
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagccgaggaaaacaccctggcactgccgcgcaccctggttctggtcgggctg
atgggggcgggcaaaacctgtatcggccgccgtctggcccagatggccggggtgccgttc
gtcgatgccgatgtcgagatcgagcgcgccgccaaacgcaccatcgccgagatcttcgcc
acctatggcgaaagcgaattccgcgccctggagcggcgggtgatggcccggttgctggcg
gggcgcacctgcgtgctggccaccggcggcggcgccttcatggccgaagacacccgcgcc
ctaatccgccttcacgggttatccttgtggctgcgcgccgatcttgatcttctggtcgcc
cgcaccgccggacgaacccaccggccgctgctcaataacggcgacgcgcgcgaaaaactg
gccgagctgatggccaagcgtcatcctgtctatgccgaggccgatatcgttttcgatgcc
cttgacgaaagccaggacgcctccgccctgcgggtgcgctcgtgccttctttcctacctc
gccgaccatgcggagaccgccccgtga

DBGET integrated database retrieval system