KEGG   Rickettsia rickettsii Sheila Smith: A1G_00440Help
Entry
A1G_00440         CDS       T00604                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rri  Rickettsia rickettsii Sheila Smith
Pathway
rri00020  Citrate cycle (TCA cycle)
rri00190  Oxidative phosphorylation
rri00650  Butanoate metabolism
rri01100  Metabolic pathways
rri01110  Biosynthesis of secondary metabolites
rri01120  Microbial metabolism in diverse environments
rri01130  Biosynthesis of antibiotics
rri01200  Carbon metabolism
Module
rri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rri_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1G_00440 (sdhB)
   00650 Butanoate metabolism
    A1G_00440 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A1G_00440 (sdhB)
Enzymes [BR:rri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A1G_00440 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A1G_00440 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: ABV75676
UniProt: A0A0H3AWR9
LinkDB All DBs
Position
65116..65901
Genome map
AA seq 261 aa AA seqDB search
MAELRLPPNSVVKKGREHKEQEEMLKPRKIKIYRYDPDLDKNPTIDSFEIDLSKTGPMVL
DALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPIEDISGDIKIYPLPHMK
VVKDLVPDMSHFYAQYESIEPWLKTDSPIPSNSERLQSIKDREKLDGVYECILCACCSTS
CPSYWWNGDKYLGPAILLQAYRWIADSRDDNTGERLEALEDPFKLYRCHTIMNCTKTCPK
GLNPAKAIGKIKSLIAERHGV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttaaggttaccgccaaattcagtagtaaaaaaaggtagagagcataaagaa
caagaggaaatgcttaaacctagaaagataaaaatttataggtatgatcctgatcttgat
aagaatcctactatcgatagttttgagatagatttaagcaaaaccggaccgatggtttta
gatgctttaattaaaatcaaaaacgaaatcgattctactttaacttttaggcgttcttgt
cgggaaggaatttgtggtagttgtgcaatgaatattgacggtacaaatactttagcatgc
ataaaaccaatagaagatatatcaggcgatatcaaaatctatccgctgcctcatatgaaa
gtagtgaaagatttagtacctgatatgtcgcatttttatgcacaatacgaatctatagaa
ccttggctcaaaactgatagccctatcccttcaaactctgaaaggttacagtcgattaaa
gaccgagaaaagcttgacggtgtatatgagtgtatattatgtgcttgctgttctacttct
tgtcctagctattggtggaacggtgataaatatttgggtcctgcgattttactacaagca
tatagatggattgccgattcaagggatgataataccggtgaacgtcttgaagctttagaa
gacccatttaagctttaccgttgtcatactattatgaactgtactaagacctgcccgaaa
ggcttaaatcctgctaaagctatcggtaaaataaaaagtttaattgcagaacgtcacggt
gtgtga

DBGET integrated database retrieval system