KEGG   Rickettsia rickettsii Iowa: RrIowa_1017Help
Entry
RrIowa_1017       CDS       T00643                                 

Gene name
ftsI
Definition
(GenBank) division specific D,D-transpeptidase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj00550  Peptidoglycan biosynthesis
rrj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rrj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RrIowa_1017 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RrIowa_1017 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rrj01011]
    RrIowa_1017 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rrj03036]
    RrIowa_1017 (ftsI)
Enzymes [BR:rrj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RrIowa_1017 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:rrj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   RrIowa_1017 (ftsI)
Chromosome and associated proteins [BR:rrj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    RrIowa_1017 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer EVI2A DUF599
Motif
Other DBs
NCBI-ProteinID: ABY72823
UniProt: B0BY97
LinkDB All DBs
Position
complement(812619..814304)
Genome map
AA seq 561 aa AA seqDB search
MKQIWEKWKPTIKSLTIWNVCSKNTKIRLLMVICVFSFLFCTLSYRLIIVATNVYDKNIN
SFKKKHQFRKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLA
ELKSNKSFIWVKRDVLPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVIGYVGRDSVG
LSGLELAYDKYLTNSDYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGI
IADPNNGEILALVNKPDFDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAI
NMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKK
LGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLY
DLTLLKRKDEKVIGTKVFSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLS
QGAGGKKKYLKNSRASSFLGMLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGR
VFERMISLYGLEPIEQSEEES
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatttgggaaaaatggaaacctacaattaaaagtctaacaatttggaatgtt
tgtagtaaaaatacaaaaatccgattattaatggttatttgtgtcttttcttttcttttt
tgtactttatcttacagattgataatcgttgctacgaatgtttacgataaaaatattaat
tcctttaaaaaaaagcatcaatttagaaaagaaatagttgatcgaaacggtaatttatta
gcagtgaacctaccttctgcctcattatttgctaatccacaaatagtacttgatcctgaa
acttccgtaaaaaagctagcagaaattctacctgatattaataaagctaaattacttgca
gaacttaagtcaaataaaagctttatatgggtaaaaagggatgtactacctagtcagcaa
gaaaagatcactagccttgggttacttggttttgaatttgaagaagagcagaaacgaatt
tataccttttctaatttattgtcgcatgttatcggttatgtaggtagagactcggtaggg
cttagtggcttagagctcgcttatgataagtatttaactaattctgattatgaattaaac
gaaccaaagaatcggaaagaaccgcttcaattatctattgatatcagattacaaagtatt
ttaagtgaggagattgataaaactttaaagcaatttaaggccataggagcagtgggtatt
attgctgatccaaataatggcgagattttagcattagtaaataagcctgatttcgatccg
cattatccgagtttagccaaaccagaagagctgtttaatatagcaagtctcgggatttac
gaaatgggttcggtgtttaaggcattaactatggcagtcggctttgataccggtgcaata
aatatgaatgatgcttatgatataagttatatgaaagtaggaggattccagcttaaggat
tatacgccaaggcaaggatggcatagtgtacctgagatttttctatattcttcaaatatt
ggcacaagtcaaattatgcttgaaatcggtaaaagcaattttaaaaaatacctaaagaaa
ttaggcctattagatcagttgcaaatagaattacctgaacgaggtactccgttatttcct
tccgagaaaagatggaatgagttaacgagtgttactatgtcgtatggctacggcatttca
attagccctttgcattttgttagagcaatgttaccggttgttaacggcggtactttatat
gatcttactttattaaaaagaaaggatgaaaaagtaataggtacaaaagtttttagtgaa
aatacctctacccaaatgaagaaattatttagagcggtagtaaaagaaggtaacggtaaa
agagcagaggtcaaaggctatcttatcggcggtaagaccggtacggcagaaaaactttca
caaggggcagggggaaaaaagaaatatctaaaaaatagtagagcgtcatcgtttttaggt
atgctgcctgcatctaacccgcaatatattatttttattagatttgatgagccgaaaccg
actaaagaaagctttggctttgcaaccgcaagttggacggctgcccctactgccggtaga
gtatttgaacgtatgatatctttatatggtttagaaccgatagaacaaagtgaggaagaa
agttaa

DBGET integrated database retrieval system