KEGG   Rickettsia rickettsii Hino: RPJ_00040Help
Entry
RPJ_00040         CDS       T01738                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
rrn00061  Fatty acid biosynthesis
rrn00780  Biotin metabolism
rrn01100  Metabolic pathways
rrn01212  Fatty acid metabolism
Module
rrn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rrn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RPJ_00040 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RPJ_00040 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rrn01004]
    RPJ_00040 (fabZ)
Enzymes [BR:rrn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RPJ_00040 (fabZ)
Lipid biosynthesis proteins [BR:rrn01004]
 Fatty acid synthase
  Component type
   RPJ_00040 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT AfsA
Motif
Other DBs
NCBI-ProteinID: AFB26976
LinkDB All DBs
Position
complement(7244..7681)
Genome map
AA seq 145 aa AA seqDB search
MIIDITEIMDWIPHRYPFLLVDRVLKIDPNKSITGIKNVTVNEPQFTGHFPARPVMPGVL
MVEAMAQLAAILVAKSLGSTKNKEVFLMTIENAKFRRIVQPGDTMHIHAVIDQQRANVWK
FSSTVTVEGEIAAESKFTAMIKDKT
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatcatagatattaccgaaatcatggattggatacctcatcgctatccatttttatta
gtagatagagtacttaaaatcgatcctaacaaatcaataacaggtattaaaaacgttact
gttaacgaaccgcaatttacaggacattttccggcaagacctgttatgcccggtgttcta
atggttgaggctatggcacaattagctgctatattagttgctaaatctttaggttctact
aagaataaagaagtgtttttaatgactatcgaaaatgcaaaatttcgtagaattgttcag
ccgggggatactatgcatatccacgctgttattgatcagcaaagagctaacgtatggaaa
ttttcaagtacggttacggtcgaaggtgaaatagctgcagaaagcaagtttaccgcaatg
attaaagataaaacatag

DBGET integrated database retrieval system