KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104653720
Entry
104653720         CDS       T03989                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01524  Platinum drug resistance
rro04014  Ras signaling pathway
rro04064  NF-kappa B signaling pathway
rro04115  p53 signaling pathway
rro04137  Mitophagy - animal
rro04140  Autophagy - animal
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05022  Pathways of neurodegeneration - multiple diseases
rro05145  Toxoplasmosis
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05168  Herpes simplex virus 1 infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104653720 (BCL2L1)
   04630 JAK-STAT signaling pathway
    104653720 (BCL2L1)
   04064 NF-kappa B signaling pathway
    104653720 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    104653720 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104653720 (BCL2L1)
   04137 Mitophagy - animal
    104653720 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    104653720 (BCL2L1)
   04215 Apoptosis - multiple species
    104653720 (BCL2L1)
   04115 p53 signaling pathway
    104653720 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104653720 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104653720 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    104653720 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104653720 (BCL2L1)
   05225 Hepatocellular carcinoma
    104653720 (BCL2L1)
   05220 Chronic myeloid leukemia
    104653720 (BCL2L1)
   05222 Small cell lung cancer
    104653720 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104653720 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    104653720 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    104653720 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104653720 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    104653720 (BCL2L1)
   05162 Measles
    104653720 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    104653720 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104653720 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104653720 (BCL2L1)
   01524 Platinum drug resistance
    104653720 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104653720 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104653720 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rro02000]
    104653720 (BCL2L1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104653720 (BCL2L1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    104653720 (BCL2L1)
Transporters [BR:rro02000]
 Other transporters
  Pores ion channels [TC:1]
   104653720 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 104653720
NCBI-ProteinID: XP_010351093
UniProt: A0A2K6QFA2
LinkDB
Position
13
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttatctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaatgcagca
gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system