KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104653890Help
Entry
104653890         CDS       T03989                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00040  Pentose and glucuronate interconversions
rro00051  Fructose and mannose metabolism
rro01100  Metabolic pathways
Module
rro_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104653890 (SORD)
   00051 Fructose and mannose metabolism
    104653890 (SORD)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104653890 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 104653890
NCBI-ProteinID: XP_010351241
UniProt: A0A2K6NU07
LinkDB All DBs
Position
Un
AA seq 357 aa AA seqDB search
MAAAAKPKNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEEGRIGNF
IVKKPMVLGHEASGTVEKVGSLVKHLKPGDRVAIEPGAPRENDEFCKSGRYNLSPSIFFC
ATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHRVLVCG
AGPIGVVSLLVAKAMGAAQVVVTDLSAPRLSKAKEIGADLVLQISKESPQEIANKVEGLL
GCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTIPLLHAALREVDIKGVFRY
CNTWPVAISMLASKSVNIKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccaagcccaagaacctttccctggtggtgcacggaccgggggacttg
cgcctggagaactatcccatccctgaaccaggcccaaatgaggtgttgctgaggatgcat
tctgttggaatctgtggctcagatgtccactactgggaggagggtcgaattgggaatttt
atcgtgaaaaagcccatggtgctgggacatgaagcttcaggaacagttgaaaaagtggga
tcattggtaaagcacctaaaaccaggtgatcgtgttgccatcgagcctggtgctccccga
gaaaatgatgaattttgcaagtctggccgatacaatctgtcgccttccatcttcttctgt
gccacaccccccgatgacggaaacctctgccggttctacaagcacaatgcagccttttgt
tacaagcttcctgacaacgtcacctttgaggaaggcgccctgattgagccactttctgtg
gggatccatgcctgcaggagaggtggagttaccctgggacacagggtccttgtgtgtgga
gctgggccaatcggggtggtctctttgctcgtggccaaggcaatgggagcagctcaagta
gtggtgactgacctgtctgctccccggttgtccaaagccaaggagattggggctgattta
gtcctccagatctccaaggagagtcctcaggaaatcgccaataaagtagaaggtctgctg
gggtgcaagccggaagtcaccattgagtgcacgggggcagaggcctccatccaggcgggc
atctacgccactcgctctggtgggaccctggtgcttgtggggctgggctctgagatgacc
accatacccctactgcatgcagccctccgggaggtggatatcaagggcgtgtttcgatac
tgcaacacgtggccagtggcgatttcgatgcttgcgtccaagtctgtgaacataaaaccc
ctcgtcacccatagatttcctctggagaaagctctggaggcctttgaaacatttaaaaag
ggattggggttgaaaatcatgctcaagtgtgatcccaatgaccagaatccctga

DBGET integrated database retrieval system