KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104653917
Entry
104653917         CDS       T03989                                 

Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04720  Long-term potentiation
rro04724  Glutamatergic synapse
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104653917
   04310 Wnt signaling pathway
    104653917
   04370 VEGF signaling pathway
    104653917
   04020 Calcium signaling pathway
    104653917
   04022 cGMP-PKG signaling pathway
    104653917
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104653917
   04218 Cellular senescence
    104653917
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104653917
   04650 Natural killer cell mediated cytotoxicity
    104653917
   04660 T cell receptor signaling pathway
    104653917
   04658 Th1 and Th2 cell differentiation
    104653917
   04659 Th17 cell differentiation
    104653917
   04662 B cell receptor signaling pathway
    104653917
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104653917
   04921 Oxytocin signaling pathway
    104653917
   04924 Renin secretion
    104653917
  09156 Nervous system
   04724 Glutamatergic synapse
    104653917
   04720 Long-term potentiation
    104653917
  09158 Development and regeneration
   04360 Axon guidance
    104653917
   04380 Osteoclast differentiation
    104653917
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104653917
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104653917
   05014 Amyotrophic lateral sclerosis
    104653917
   05020 Prion disease
    104653917
   05022 Pathways of neurodegeneration - multiple diseases
    104653917
  09165 Substance dependence
   05031 Amphetamine addiction
    104653917
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104653917
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104653917
   05170 Human immunodeficiency virus 1 infection
    104653917
   05163 Human cytomegalovirus infection
    104653917
   05167 Kaposi sarcoma-associated herpesvirus infection
    104653917
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104653917
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     104653917
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 104653917
NCBI-ProteinID: XP_030790346
LinkDB
Position
7
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgaaggcgtctct
cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggcgatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663623
Entry
104663623         CDS       T03989                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04720  Long-term potentiation
rro04724  Glutamatergic synapse
rro04728  Dopaminergic synapse
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104663623 (PPP3CA)
   04310 Wnt signaling pathway
    104663623 (PPP3CA)
   04370 VEGF signaling pathway
    104663623 (PPP3CA)
   04020 Calcium signaling pathway
    104663623 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    104663623 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104663623 (PPP3CA)
   04218 Cellular senescence
    104663623 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104663623 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    104663623 (PPP3CA)
   04660 T cell receptor signaling pathway
    104663623 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    104663623 (PPP3CA)
   04659 Th17 cell differentiation
    104663623 (PPP3CA)
   04662 B cell receptor signaling pathway
    104663623 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104663623 (PPP3CA)
   04921 Oxytocin signaling pathway
    104663623 (PPP3CA)
   04924 Renin secretion
    104663623 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    104663623 (PPP3CA)
   04728 Dopaminergic synapse
    104663623 (PPP3CA)
   04720 Long-term potentiation
    104663623 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    104663623 (PPP3CA)
   04380 Osteoclast differentiation
    104663623 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104663623 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104663623 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    104663623 (PPP3CA)
   05020 Prion disease
    104663623 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    104663623 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    104663623 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104663623 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104663623 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    104663623 (PPP3CA)
   05163 Human cytomegalovirus infection
    104663623 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104663623 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104663623 (PPP3CA)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104663623 (PPP3CA)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     104663623 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 104663623
NCBI-ProteinID: XP_030770967
LinkDB
Position
2
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcctaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcacatcttatgaaggagggaagactggaagagagtgtt
gcattgagaataataacagagggtgcatcaattcttcgacaggaaaaaaacttgctggat
attgatgcgccagtcacagtttgtggggacattcatggacaattctttgacttgatgaag
ctctttgaagttgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtattgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgacgcctgtatggat
gcctttgactgccttcccttggctgccctgatgaaccaacagttcctgtgtgtacatggt
ggcttgtctccagagattaacaccttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatacttcgagcc
catgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacagggttccct
tctctaatcacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtccctgccttttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctctgatgatgaactagggtcagaa
gaagatggatttgatggtgcaacagctgcagcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccgactggcatgctccccagcggagtactttctggaggg
aagcaaaccctacaaagcgctatcaaaggattttcaccacaacataagatcactagcttc
gaggaagccaagggcttagaccgaattaatgagaggatgccgcctcgcagagatgccatg
ccctctgacgccaaccttaactccatcaacaaggctctcacctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatattcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663969
Entry
104663969         CDS       T03989                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04720  Long-term potentiation
rro04724  Glutamatergic synapse
rro04728  Dopaminergic synapse
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104663969 (PPP3CC)
   04310 Wnt signaling pathway
    104663969 (PPP3CC)
   04370 VEGF signaling pathway
    104663969 (PPP3CC)
   04020 Calcium signaling pathway
    104663969 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    104663969 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104663969 (PPP3CC)
   04218 Cellular senescence
    104663969 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104663969 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    104663969 (PPP3CC)
   04660 T cell receptor signaling pathway
    104663969 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    104663969 (PPP3CC)
   04659 Th17 cell differentiation
    104663969 (PPP3CC)
   04662 B cell receptor signaling pathway
    104663969 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104663969 (PPP3CC)
   04921 Oxytocin signaling pathway
    104663969 (PPP3CC)
   04924 Renin secretion
    104663969 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    104663969 (PPP3CC)
   04728 Dopaminergic synapse
    104663969 (PPP3CC)
   04720 Long-term potentiation
    104663969 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    104663969 (PPP3CC)
   04380 Osteoclast differentiation
    104663969 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104663969 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104663969 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    104663969 (PPP3CC)
   05020 Prion disease
    104663969 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    104663969 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    104663969 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104663969 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104663969 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    104663969 (PPP3CC)
   05163 Human cytomegalovirus infection
    104663969 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104663969 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104663969 (PPP3CC)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104663969 (PPP3CC)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     104663969 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 104663969
NCBI-ProteinID: XP_010363672
UniProt: A0A2K6QD80
LinkDB
Position
9
AA seq 520 aa
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEDHYIPSYQKGSTTVRKEIIRSKIRAIGKMARVFSILRQES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLD
RINERMPPRKDSIHADGPMKSVTSAHSHAAHRSDQGKKAQ
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtccgggaggcgcttccacctctccaccaccgaccgcgtcatcaaagctgtccctttt
cctccaacccaacggcttactttcaaggaagtatttgagaatgggaaacctaaagttgat
gttttaaaaaaccatttggtaaaggaaggacgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgaggcaagagaagactatgatagaagtagatgctcca
atcacagtgtgtggtgatattcatggacaattctttgacctaatgaaattatttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
ttcctgcttcggggaaatcatgaatgcaggcatcttacagactatttcaccttcaaacag
gaatgtcgaatcaaatattcggaacaggtgtatgatgcctgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattacttctttagatgacattaggaaattagacaggtttacagaacctcctgccttt
ggacctgtgtgtgacctgctttggtctgatccttcagaggattatggcaatgagaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttattatcaattatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaagcaacaggctttccatcacttattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaattgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggtaaatgtgctcaacatatgctctgatgatgaactgatttctgatgatgaagcagaa
gatcactacattccaagctatcagaaaggaagcactacagttcgtaaggagatcatcagg
agtaagatcagagccattgggaagatggcacgggtcttttcaattcttcggcaagaaagt
gagagtgtgctgactctcaagggcctgactcccacaggcacgctccctctgggtgtcctc
tcaggaggcaagcagactatcgagacggccacagtagaagcggtagaggcccgggaagcc
atcagagggttctcgcttcagcacaagatccggagttttgaagaagcacgaggtctggac
cgaattaatgaacgaatgccaccccgaaaagatagcatacatgctgatgggccaatgaaa
tctgtaacctcagcacactcacatgctgcacacaggagcgaccaagggaagaaagcccag
taa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669965
Entry
104669965         CDS       T03989                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04720  Long-term potentiation
rro04724  Glutamatergic synapse
rro04728  Dopaminergic synapse
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104669965 (PPP3CB)
   04310 Wnt signaling pathway
    104669965 (PPP3CB)
   04370 VEGF signaling pathway
    104669965 (PPP3CB)
   04020 Calcium signaling pathway
    104669965 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    104669965 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104669965 (PPP3CB)
   04218 Cellular senescence
    104669965 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104669965 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    104669965 (PPP3CB)
   04660 T cell receptor signaling pathway
    104669965 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    104669965 (PPP3CB)
   04659 Th17 cell differentiation
    104669965 (PPP3CB)
   04662 B cell receptor signaling pathway
    104669965 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104669965 (PPP3CB)
   04921 Oxytocin signaling pathway
    104669965 (PPP3CB)
   04924 Renin secretion
    104669965 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    104669965 (PPP3CB)
   04728 Dopaminergic synapse
    104669965 (PPP3CB)
   04720 Long-term potentiation
    104669965 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    104669965 (PPP3CB)
   04380 Osteoclast differentiation
    104669965 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104669965 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104669965 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    104669965 (PPP3CB)
   05020 Prion disease
    104669965 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    104669965 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    104669965 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104669965 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104669965 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    104669965 (PPP3CB)
   05163 Human cytomegalovirus infection
    104669965 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104669965 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104669965 (PPP3CB)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104669965 (PPP3CB)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     104669965 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 104669965
NCBI-ProteinID: XP_010371397
LinkDB
Position
11
AA seq 525 aa
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVF
SVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSF
EEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccgcccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccccccaacacatcgcttgacatct
gaagaagtatttgatttggatggaatacccagggttgatgttctgaagaaccacttggta
aaagaaggtcgagtagatgaagaaattgcgcttagaattatcaacgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaatcacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggcgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggttctgaagattctatacccaagcacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaagtattcg
gaaagagtctatgaagcttgtatggaagcttttgatagtttgcctcttgctgcactttta
aaccaacagtttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcgtttggaccaatgtgtgacttgtta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcccaattttatggatgtcttcaca
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatgtaggttcagctgca
gcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttc
tctgttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacaggg
atgttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgccacagttgag
gctattgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagtttt
gaagaggcaaagggtttggataggatcaatgagagaatgccacctcggaaagatgctgta
cagcaagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggacgggc
aaccatactgcccagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670806
Entry
104670806         CDS       T03989                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04720  Long-term potentiation
rro04724  Glutamatergic synapse
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104670806 (PPP3R2)
   04310 Wnt signaling pathway
    104670806 (PPP3R2)
   04370 VEGF signaling pathway
    104670806 (PPP3R2)
   04020 Calcium signaling pathway
    104670806 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    104670806 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104670806 (PPP3R2)
   04218 Cellular senescence
    104670806 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104670806 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    104670806 (PPP3R2)
   04660 T cell receptor signaling pathway
    104670806 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    104670806 (PPP3R2)
   04659 Th17 cell differentiation
    104670806 (PPP3R2)
   04662 B cell receptor signaling pathway
    104670806 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104670806 (PPP3R2)
   04921 Oxytocin signaling pathway
    104670806 (PPP3R2)
   04924 Renin secretion
    104670806 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    104670806 (PPP3R2)
   04720 Long-term potentiation
    104670806 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    104670806 (PPP3R2)
   04380 Osteoclast differentiation
    104670806 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104670806 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104670806 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    104670806 (PPP3R2)
   05020 Prion disease
    104670806 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    104670806 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    104670806 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670806 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104670806 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    104670806 (PPP3R2)
   05163 Human cytomegalovirus infection
    104670806 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670806 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104670806 (PPP3R2)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     104670806 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 104670806
NCBI-ProteinID: XP_010372459
LinkDB
Position
16
AA seq 173 aa
MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTNDDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLADWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtccacaatgggaaatgaggccagttacccggcggagatgtgcgcgcactttgacaat
gatgaaattaaaaggctgggcaggaggtttaggaagttggacttggacaaatcaggctct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccaacgacgatggagaagtggacttcaaggaattcatcctg
gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctggcggactggcagctccagcagctggtcgacaaaaccatc
atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675975
Entry
104675975         CDS       T03989                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04114  Oocyte meiosis
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04720  Long-term potentiation
rro04724  Glutamatergic synapse
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104675975 (PPP3R1)
   04310 Wnt signaling pathway
    104675975 (PPP3R1)
   04370 VEGF signaling pathway
    104675975 (PPP3R1)
   04020 Calcium signaling pathway
    104675975 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    104675975 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104675975 (PPP3R1)
   04218 Cellular senescence
    104675975 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104675975 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    104675975 (PPP3R1)
   04660 T cell receptor signaling pathway
    104675975 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    104675975 (PPP3R1)
   04659 Th17 cell differentiation
    104675975 (PPP3R1)
   04662 B cell receptor signaling pathway
    104675975 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    104675975 (PPP3R1)
   04921 Oxytocin signaling pathway
    104675975 (PPP3R1)
   04924 Renin secretion
    104675975 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    104675975 (PPP3R1)
   04720 Long-term potentiation
    104675975 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    104675975 (PPP3R1)
   04380 Osteoclast differentiation
    104675975 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104675975 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104675975 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    104675975 (PPP3R1)
   05020 Prion disease
    104675975 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    104675975 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    104675975 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104675975 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104675975 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    104675975 (PPP3R1)
   05163 Human cytomegalovirus infection
    104675975 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104675975 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104675975 (PPP3R1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     104675975 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 104675975
NCBI-ProteinID: XP_030777323
LinkDB
Position
17
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgaaggcgtctct
cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggcgatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system