KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104653928Help
Entry
104653928         CDS       T03989                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104653928 (RET)
   05230 Central carbon metabolism in cancer
    104653928 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104653928 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104653928 (RET)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104653928 (RET)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  RET family
   104653928 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD3 RET_CLD4 Pkinase RIO1 Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104653928
NCBI-ProteinID: XP_010351276
LinkDB All DBs
Position
Un
AA seq 818 aa AA seqDB search
MVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTIVATLRVFDADVVPASGELVRRY
TSTLLPRDTWTQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLSISENRTMQLAV
LVNDSDFQGPGTGVLLLHFNVSVLPVSLHLPSSYSLSVSRRARRFAQIGKVCVENCQAFS
GINVQYELHSSGANCSTLGVVTSPEDTSGILFVNDTKALRRPKCAELHYMVVATDHQTSR
QAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRPECEECGGLGSPTGRCEWRQGDGKGITRN
FSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPE
EEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHRYHKFAHKPPIPSAEM
TFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEFPRKNLVLGKTLGEGE
FGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLLKQVNHPHVIKLYGAC
SQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISF
AWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSKGRIP
VKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPD
NCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAASTPSDSLLYDDGLS
EEETPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccttcccggtgaccgtgtacgacgaggacgactcggcgcccacattccccgcg
ggcgtcgacaccgccagcgccgtggtggagttcaagcggaaggaggacaccatagtggcc
actctgcgtgtcttcgatgcagacgtggtacctgcgtcaggggagctggtgaggcggtac
acaagcacgctgctccccagggacacctggacccagcagaccttccgggtggagcactgg
cccaacgagacctcggtccaggccaacggcagcttcgtgcgggcgaccgtacatgactat
aggctggttctcaatcggaacctctccatctcggagaaccgcaccatgcagctggctgtg
ctggtcaatgactcggacttccagggcccaggaacgggcgtcctcttgctccacttcaac
gtgtcggtgctgccggtcagcctgcacctgcccagtagctactccctctctgtgagtagg
agggctcgtcgatttgcccagatcgggaaagtctgtgtggaaaactgccaggcgttcagt
ggcatcaatgtccagtatgagctgcattcctccggcgccaactgcagcacgctaggggtg
gtcacctcgcctgaggacacctcggggatcctgtttgtgaacgacaccaaggccctgcga
cggcccaagtgtgctgagcttcactacatggtggtggccaccgaccatcagacctccagg
caggcccaggcccagctgcttgtcacggtggaggggtcgtatgtggccgaggaggcgggc
tgccccctgtcctgtgcagtcagcaagagacggccagagtgtgaggagtgtggcggcctg
ggatccccaacgggcaggtgtgagtggaggcaaggagatggcaaagggatcaccaggaac
ttctccacctgctctcccagcaccaagacttgccccgatggccactgcgatgtcgtggag
acccaagacatcaacatttgcccccaggactgcctccggggcagcattgtcggcgggcat
gagcccggggagccccgggggattaaagctggctatggcacctgcaactgcttccctgag
gaggagaagtgcttctgcgagcccgaagacatccaggatccactgtgcgacgagctgtgc
cgcacggtgattgcagccgccgtcctcttctccttcatcgtttcggtgctgctgtctgcc
ttctgcatccaccgctaccacaagtttgcccacaagccacccatcccctcagctgagatg
acctttcggaggcccgcccaggccttcccggtcagctactcctcttccggcgcccgccgg
ccctcgctcgactccatggagaaccaggtctctgtggatgccttcaagatcccggaggat
ccaaagtgggaattccctcggaagaacttggttcttggaaaaactctaggagaaggtgaa
tttggaaaagtggtcaaggcaacggccttccgtctgaaaggcagagcagggtacaccaca
gtggccgtgaagatgctgaaagagaacgcctccccgagtgagctgcgagacctgctgtca
gagttcaacctcctgaagcaggtcaaccacccacatgtcatcaaattgtatggtgcctgc
agccaggatggcccgctcctcctcattgtggagtacgccaagtacggctccctgcggggc
ttcctccgtgagagccgcaaggtggggcccggctacctgggcagtggaggcagccgcaac
tccagctccctggaccacccagacgagcgggccctcaccatgggcgacctcatctcattt
gcctggcagatctcacgggggatgcagtacctggccgagatgaagctcgttcatcgggac
ttggcagccagaaacatcctggtagctgaggggcggaagatgaagatttcggatttcggc
ctgtcccgagatgtttatgaagaggattcctacgtgaagaggagcaagggtcggattcca
gttaaatggatggcaattgagtccctttttgatcatatctacaccacccaaagtgatgta
tggtctttcggtgtcctgctgtgggagatcgtgaccctagggggcaacccctatcctggg
attcctcctgagcggctcttcaaccttctgaagaccggccaccggatggagaggccagac
aactgcagcgaggagatgtaccgcctgatgctgcagtgctggaagcaggagccagacaaa
aggccggtgtttgcggacatcagcaaagacctggagaagatgatggttaaaagcagagac
tacttggaccttgcggcgtccactccgtccgactccctgctttatgacgacggcctctca
gaggaggagacacccctggtggactgtaataatgcccccctccctcgagccctcccttcc
acatggattgaaaacaaactctatggtagaatttcccatgcatttactagattctag

DBGET integrated database retrieval system