KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104653928
Entry
104653928         CDS       T03989                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro05200  Pathways in cancer
rro05216  Thyroid cancer
rro05223  Non-small cell lung cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104653928 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104653928 (RET)
   05230 Central carbon metabolism in cancer
    104653928 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104653928 (RET)
   05223 Non-small cell lung cancer
    104653928 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104653928 (RET)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104653928 (RET)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  RET family
   104653928 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin Pkinase_fungal RIO1 FOXP-CC
Other DBs
NCBI-GeneID: 104653928
NCBI-ProteinID: XP_030796658
LinkDB
Position
11
AA seq 1115 aa
MAKATSGAAGLRLLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQPAGTPLLYVHALRDA
PEEVPSFRLGQHLYGTYRTRLHENNWIGIQEHTGLLYLNQSLDRSSWEKLSGRNRGFPLL
TVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACTSLKPRELCFPETRPSFRIREN
RPPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYEL
VAVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTIVATLRVF
DADVVPASGELVRRYTSTLLPRDTWTQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLN
RNLSISENRTMQLAVLVNDSDFQGPGTGVLLLHFNVSVLPVSLHLPSSYSLSVSRRARRF
AQIGKVCVENCQAFSGINVQYELHSSGANCSTLGVVTSPEDTSGILFVNDTKALRRPKCA
ELHYMVVATDHQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRPECEECGGLGSPTG
RCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEP
RGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHR
YHKFAHKPPIPSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEF
PRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLL
KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLD
HPDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDV
YEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPER
LFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLA
ASTPSDSLLYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTR
ADGTNTGFPRYANDSVYANWMLSPSAAKLMDTFDS
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacgtccggtgccgcggggctgcggttgctgttgctgctgctgctgctg
ccgctgctgggcaaagtggcattgggcctctacttctcaagggatgcttactgggagaag
ctgtatgtggaccagccggctggcacacccttgctgtacgttcacgccctgcgggacgcc
cctgaggaggtgcccagcttccgcctgggccagcacctctacggcacgtaccgcacacgg
ctgcatgagaacaactggatcggcatccaggagcacaccggcctcctctaccttaatcag
agcctggaccgcagctcctgggagaagctcagtggccgcaaccgcggcttccccctgctc
accgtctacctcaaggtattcctgtcacccacgtcccttcgtgagggcgagtgccagtgg
ccaggctgtgcccgcgtgtacttctccttcttcaacacctcctttccagcttgcacctct
ctcaagccccgggagctctgcttcccagagacaaggccctccttccgcattcgggagaac
cgacccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttgtgccccaac
atcagcgtggcctacaggctcctggagggtgagggtctgcccttccgctgcgccccggac
agcctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaagtacgagctg
gtggccgtgtgcaccgtgcacgccggcgcgcgcgaggaggtggtaatggtgcccttcccg
gtgaccgtgtacgacgaggacgactcggcgcccacattccccgcgggcgtcgacaccgcc
agcgccgtggtggagttcaagcggaaggaggacaccatagtggccactctgcgtgtcttc
gatgcagacgtggtacctgcgtcaggggagctggtgaggcggtacacaagcacgctgctc
cccagggacacctggacccagcagaccttccgggtggagcactggcccaacgagacctcg
gtccaggccaacggcagcttcgtgcgggcgaccgtacatgactataggctggttctcaat
cggaacctctccatctcggagaaccgcaccatgcagctggctgtgctggtcaatgactcg
gacttccagggcccaggaacgggcgtcctcttgctccacttcaacgtgtcggtgctgccg
gtcagcctgcacctgcccagtagctactccctctctgtgagtaggagggctcgtcgattt
gcccagatcgggaaagtctgtgtggaaaactgccaggcgttcagtggcatcaatgtccag
tatgagctgcattcctccggcgccaactgcagcacgctaggggtggtcacctcgcctgag
gacacctcggggatcctgtttgtgaacgacaccaaggccctgcgacggcccaagtgtgct
gagcttcactacatggtggtggccaccgaccatcagacctccaggcaggcccaggcccag
ctgcttgtcacggtggaggggtcgtatgtggccgaggaggcgggctgccccctgtcctgt
gcagtcagcaagagacggccagagtgtgaggagtgtggcggcctgggatccccaacgggc
aggtgtgagtggaggcaaggagatggcaaagggatcaccaggaacttctccacctgctct
cccagcaccaagacttgccccgatggccactgcgatgtcgtggagacccaagacatcaac
atttgcccccaggactgcctccggggcagcattgtcggcgggcatgagcccggggagccc
cgggggattaaagctggctatggcacctgcaactgcttccctgaggaggagaagtgcttc
tgcgagcccgaagacatccaggatccactgtgcgacgagctgtgccgcacggtgattgca
gccgccgtcctcttctccttcatcgtttcggtgctgctgtctgccttctgcatccaccgc
taccacaagtttgcccacaagccacccatcccctcagctgagatgacctttcggaggccc
gcccaggccttcccggtcagctactcctcttccggcgcccgccggccctcgctcgactcc
atggagaaccaggtctctgtggatgccttcaagatcccggaggatccaaagtgggaattc
cctcggaagaacttggttcttggaaaaactctaggagaaggtgaatttggaaaagtggtc
aaggcaacggccttccgtctgaaaggcagagcagggtacaccacagtggccgtgaagatg
ctgaaagagaacgcctccccgagtgagctgcgagacctgctgtcagagttcaacctcctg
aagcaggtcaaccacccacatgtcatcaaattgtatggtgcctgcagccaggatggcccg
ctcctcctcattgtggagtacgccaagtacggctccctgcggggcttcctccgtgagagc
cgcaaggtggggcccggctacctgggcagtggaggcagccgcaactccagctccctggac
cacccagacgagcgggccctcaccatgggcgacctcatctcatttgcctggcagatctca
cgggggatgcagtacctggccgagatgaagctcgttcatcgggacttggcagccagaaac
atcctggtagctgaggggcggaagatgaagatttcggatttcggcctgtcccgagatgtt
tatgaagaggattcctacgtgaagaggagcaagggtcggattccagttaaatggatggca
attgagtccctttttgatcatatctacaccacccaaagtgatgtatggtctttcggtgtc
ctgctgtgggagatcgtgaccctagggggcaacccctatcctgggattcctcctgagcgg
ctcttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagcgaggag
atgtaccgcctgatgctgcagtgctggaagcaggagccagacaaaaggccggtgtttgcg
gacatcagcaaagacctggagaagatgatggttaaaagcagagactacttggaccttgcg
gcgtccactccgtccgactccctgctttatgacgacggcctctcagaggaggagacaccc
ctggtggactgtaataatgcccccctccctcgagccctcccttccacatggattgaaaac
aaactctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgaga
gctgatggcactaacactgggtttccaagatatgcaaatgatagtgtatatgctaactgg
atgctttcaccctcagcggcaaaattaatggacacgtttgatagttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663676
Entry
104663676         CDS       T03989                                 

Gene name
CCDC6
Definition
(RefSeq) LOW QUALITY PROTEIN: coiled-coil domain-containing protein 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05200  Pathways in cancer
rro05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104663676 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104663676 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 104663676
NCBI-ProteinID: XP_010363251
UniProt: A0A2K6Q595
LinkDB
Position
11
AA seq 474 aa
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSVHPSSQP
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcgtcctgctcgtctacctcgggcggcggcggcggcggcgggggaggc
ggcggcggtggaaagtcggggggcattgtcatctcgccgttccgcctggaggagctcacc
aaccgcctggcctcgctgcagcaagagaacaaggtgctgaagatagagctggagacctac
aaactgaagtgcaaggcactgcaggaggagaaccgcgacctgcgcaaagccagcgtgacc
atccaagccagggctgagcaggaagaagaattcattagtaacactttattcaagaaaatt
caggctttgcagaaggagaaagaaacacttgctgtaaattatgagaaagaagaagagttc
ctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagctgaactagaa
cagcatcttgaacaagagcaggaatttcaggtcaacaaactgatgaagaaaattaaaaaa
ctggagaatgacaccatttctaagcaacttacattagaacagttgagacgggagaagatt
gaccttgaaaatacattggaacaagaacaagaagcactagttaatcgcctctggaaaagg
atggataagcttgaagctgaaaagcgaatcctgcaggaaaaattagaccagcccgtctct
gctccaccatcgcctagagatatctccatggagattgattctccagaaaatatgatgcgt
cacatcaggtttttaaagaatgaagtggaacggctgaagaaacaactaagagccgctcag
ttacagcattcagagaaaatggcacagtatctggaggaggaacgtcacatgagggaagag
aacttgaggctgcagaggaagctgcagagggagatggagagaagagaagccctctgtcga
cagctctccgagagtgagtccagcttagaaatggatgacgaaaggtattttaatgagatg
tcagcacaaggattaagacctcgcactgtgtccagcccgattccttacacgccttctccg
agttcaagcaggcctatatcacctggtctatcatatgcaagtcacacggttggtttcacg
ccaccaacttcactgacgagagccggaatgtcttattacaattccccgggtcttcacgtg
cagcacatgggaacatcccacggtatcacaaggccttcaccacggagaagcaacagtcct
gacaaattcaaacggcccacgccgcctccatctcccaacacacagaccccagtccagcca
cctccgcctccacctccgccacccatgcagcccacagtcccctcagcagccacctcgcag
cccactccttcgcaacattcggtgcacccctcctcccagccttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667790
Entry
104667790         CDS       T03989                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4 isoform X1
  KO
K09289  nuclear receptor coactivator 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04216  Ferroptosis
rro05200  Pathways in cancer
rro05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    104667790 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667790 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104667790 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 104667790
NCBI-ProteinID: XP_010368650
UniProt: A0A2K6PU63
LinkDB
Position
11
AA seq 614 aa
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFNCLTHQLECTQNKDLANQVSV
CLERLDSLTLKPEDSTVLLFEADTAALRQTITTFGSLKTIQIPEHLMAHASSSNIGPFLE
KRGYIPMPEQKSASSIVAVPLSEWLLGSKPASGHQAPYIPSTDPQVWLTQKQTLENSQTS
PRACNFFSNVWGNLKGLENWLLKSEKPSYQKCNSHSTTSSFSTEMEKVGDQELPDQDEMD
LSDWLVTPQESHKLRKPENESRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEI
ENLGNLKCLNDHLETKKQLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
NCEKEALYKWLLKKEGKDKNGMPVEPKPESEKHKDSLNMWLCPSRKEVIEQTKAPKAIPS
RIADSFQVIKNSPLSEWLIRTPYKEGSPKEVPSTEDRDGKQKFKSPMNTSWCSFNTADWV
LPGKKMGNLSQLPSGEDKWLLRKKAQEVLLNSPLEEEHNFPPDYYSFPAVCDLFACMQLK
VDKEKWLYRTPLQM
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgaataccttccaagaccagagtggcagctccagtaatagagaaccccttttgaggtgt
agtgatgcacggagggacttggagcttgctattggtggagttctccgggctgaacagcaa
attaaagataacttgcgagaggtcaaagctcagattcacagttgcataagccgtcacctg
gaatgtcttagaagccgtgaggtgtggctgtatgaacaggtggaccttatttatcagctt
aaagaggagacacttcaacagcaggctcagcagctctactggttattgggccaattcaat
tgtcttactcatcaactggagtgtacccaaaacaaagatctagccaatcaagtctctgtg
tgcctggagagactggacagtttgacccttaagcctgaagattcaactgtcctgctcttt
gaagctgacacagctgctctgcgccagaccatcaccacatttgggtctctcaaaaccatt
caaattcctgagcacttgatggctcatgctagttcatcaaatattgggcccttcctggag
aagagaggctatatcccaatgccagagcagaagtcagcatccagtattgtagctgtccct
ctcagcgaatggctccttggaagcaaacctgccagtggtcatcaggctccttacatacct
agcaccgacccccaggtctggctcacccaaaagcagaccttggagaacagtcagacttct
cccagagcctgcaatttcttcagtaatgtctggggaaacctaaagggcttagaaaactgg
ctcctcaagagtgaaaaaccaagttatcaaaagtgtaacagccattccactactagttct
ttctccactgaaatggaaaaggttggagatcaagagcttcctgatcaagatgagatggac
ctatcagattggctagtgactccccaggaatcccataagctgcggaagcctgagaatgaa
agtcgtgaaaccagtgagaagtttaagctcttgttccagtcctataatgtgaatgattgg
cttgtcaagactgactcctgtaccaactgtcagggaaaccagcccaaaggtgtggagatt
gaaaacctgggcaatctgaagtgcctgaatgaccacttggagaccaagaaacagttgtcc
acccccagcatggttacagaggattggcttgtccagaaccatcaggacccgtgtaaggta
gaagaagtgtgcagagccaatgagccctgcacaagctttgcagagtgtgtgtgtgatgag
aattgtgagaaggaggctctgtataaatggcttctgaagaaagaaggaaaggataaaaat
gggatgcctgtggaacccaaacctgagtctgagaagcataaagattccctgaatatgtgg
ctctgtccttctagaaaagaagtaatagaacaaactaaagcaccaaaggcaattccttct
agaattgctgattccttccaagtcataaagaacagccccttgtcggagtggcttatcagg
accccatacaaagaaggaagtcccaaggaagtgcctagtactgaagacagagatggcaaa
caaaagtttaaaagccccatgaacacttcctggtgttcctttaacacagctgactgggtc
ctgccaggaaagaagatgggcaacctcagccagttaccctctggagaagacaagtggctg
cttcgaaagaaggcccaggaagtattacttaattcacctttagaggaagaacataacttc
cccccagactattacagcttccctgcagtttgtgatctctttgcctgtatgcaacttaaa
gttgataaagagaagtggttatatcgaactcctctacagatgtga

DBGET integrated database retrieval system