KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104653963
Entry
104653963         CDS       T03989                                 

Gene name
ETS1
Definition
(RefSeq) protein C-ets-1 isoform X2
  KO
K02678  C-ets-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04218  Cellular senescence
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104653963 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104653963 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104653963 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    104653963 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104653963 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104653963 (ETS1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    104653963 (ETS1)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 104653963
NCBI-ProteinID: XP_010351330
UniProt: A0A2K6NIG6
LinkDB
Position
15
AA seq 441 aa
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPTYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR
ASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacggaaaaagtcgat
ctggagcttttcccttccccggatatggagtgtgcagatgtcccactattaactccgagc
agcaaagaaatgatgtctcaagcattaaaagctactttcagtggtttcactaaagaacag
caacgactggggatccccaaagacccccggcagtggacagaaacccatgttcgggactgg
gtgatgtgggctgtgaatgaattcagcctgaaaggtgtagacttccagaagttctgtatg
aacggagcagccctctgtgccctgggtaaagactgctttctcgagctggccccagacttt
gttggggacatcttatgggaacatctagagatcctgcagaaagaggatgtgaaaccatat
caagttaatggagtcaacccaacctatccagaatcccgctatacctcggattacttcatt
agctatggtatcgagcatgcccagtgtgttccaccatccgagttctcagagcccagcttt
atcacagagtcctatcagacgctccatcccatcagctcggaagagctcctctctctcaag
tatgagaacgactacccctcggtcattctccgggaccctctccagacagacaccttgcag
aacgactactttgctatcaaacaagaagtcgtcaccccagacaacatgtgcatggggaga
gccagtcgtggtaaactcgggggccaggactcttttgaaagcatagagagctacgatagt
tgtgatcgcctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtt
ccctcctatgacagcttcgactcagaggactatccggctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgggaccgtgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctagctggctacacaggcagtggaccaatccagctgtggcagttt
cttctggaattactcactgataaatcctgtcagtcttttatcagctggacaggagatggc
tgggaattcaaactttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggcctacgctactattacgacaaaaac
atcatccacaagacagcggggaaacgctacgtgtaccgctttgtgtgtgacctgcagagc
ctgctggggtacacccctgaggagctgcacgccatgctggacgtcaagccagatgctgat
gagtga

DBGET integrated database retrieval system