KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654017
Entry
104654017         CDS       T03989                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X4
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104654017 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104654017 (TPP2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     104654017 (TPP2)
Peptidases and inhibitors [BR:rro01002]
 Serine peptidases
  Family S8: subtilisin family
   104654017 (TPP2)
Chaperones and folding catalysts [BR:rro03110]
 Intramolecular chaperones
  Subtilisin family
   104654017 (TPP2)
SSDB
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Other DBs
NCBI-GeneID: 104654017
NCBI-ProteinID: XP_010351391
UniProt: A0A2K6R1N1
LinkDB
Position
18
AA seq 1249 aa
MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTAAEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRR
ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR
RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
ERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE
FTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAA
NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQA
QDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLK
FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggccaccgctgcgactgaggagcccttcccttttcacggtctcctgccgaagaaggag
accggagccgcctccttcctctgccgctacccggagtatgacgggcggggggtactcatc
gccgtcctggacacgggggtggacccgggggctccgggcatgcaggttacaactgatgga
aaaccaaaaatcattgatatcatcgatacaacaggaagtggcgatgtgaatactgctgcg
gaagtagagccgaaggatggtgaaattgttggtctttcaggaagagtgcttaagattcct
gcaagctggacaaatccctcaggcaaatatcatattggcataaaaaatggctatgacttc
tatcctaaggctctcaaggaaaggatacagaaagaacggaaggaaaagatctgggaccct
gttcacagagtggcccttgcagaagcctgtagaaaacaggaagaatttgatgttgccaac
aacggctcttctcaagcaaataaactcatcaaggaggaacttcaaagtcaagtggaattg
ctgaattctttcgagaagaaatacagtgatcctggccctgtatatgactgcttggtatgg
catgatggcgaagtctggagagcctgcattgattctaatgaagatggggacttgagtaaa
tctaccgtattgagaaactacaaagaagcccaagaatatggctcttttggcacagctgag
atgttgaattactccgttaatatatacgatgatggaaacctgctctccattgtgaccagc
ggaggagctcatgggacacatgtagctagtatagctgctggacactttccagaagaacct
gaacggaatggggtagctcctggtgctcagattctttccatcaagattggtgatacaaga
ctaagcacaatggaaacaggcacaggcctcataagagctatgatagaagttataaatcat
aagtgtgatcttgtcaactacagttacggagaagcaactcactggccaaactctgggaga
atttgtgaagtaattaacgaagcagtatggaagcataatataatttatgtttcaagtgct
ggaaataatggtccatgcctgtctacagttggttgtccaggtggaactacatcaagtgtg
ataggtgttggtgcttatgtttctcctgatatgatggttgctgagtattcactgagagag
aaattacctgcaaatcaatacacttggtcttctagaggacctagtgctgacggagccctt
ggtgtgagtatcagtgcaccaggaggagccattgcttctgttcctaactggacattgaga
gggacgcagctaatgaatggaacatctatgtcttcccccaatgcatgtggaggcattgcc
ttgatcctttcaggtctgaaagctaataacattgactacacagttcattcagtcagaaga
gctctagaaaacactgcagtgaaggctgacaatatagaagtatttgctcaaggacatggt
attattcaggttgataaagcctatgactacctcgttcagaatacatcatttgctaataaa
ttaggttttactgttactgttggaaataaccgtggcatctacctccgagatcctgttcag
gtggctgcaccttcagatcatggcgttggcattgaacctgtatttccagagaacacagaa
aactctgaaaaaatatcccttcagcttcatttagctctgacttcaaattcatcttgggtt
cagtgtcctagccatttggaactcatgaatcaatgtagacacataaacatacgtgtggat
cccaggggcttaagagaaggattgcattatacagaggtatgtggctatgatatagcatcc
cctaatgcaggtccgctcttccgagttcccatcactgcagttatagcagccaaagtaaat
gaatcatcacattacgatctagcctttacagatgtacactttaaacctggccaaattcga
aggcattttattgaggttcctgagggtgcaacatgggctgaagtgacagtgtgttcgtgt
tcttctgaggtatcagcaaagtttgttcttcatgcagtccagcttgtgaagcaaagagca
tatcgaagccatgaattctataagttttgttctcttccagagaaaggaacactgactgaa
gcttttcctgtcctaggtggaaaagcaattgaattttgcattgctcgttggtgggcaagt
ctcagtgatgtcaacattgattataccatttctttccatgggatagtgtgtactgctcct
cagttaaacattcatgcgtcggaaggaatcaaccgttttgatgttcaatcctccttgaaa
tacgaagatctggctccctgcataactttaaagaactgggtccaaacactacgcccagtg
agtgcaaaaacaaaacctttaggatcaagagatgttttgccaaataaccgtcaactttat
gagatggtcctgacatacaactttcatcaacccaagagtggggaagtgactccaagctgc
ccactactttgtgaactattatatgaatctgaatttgacagccaactgtggattattttt
gaccagaacaaaagacagatgggttcaggtgatgcctatccacatcagtattctttgaaa
ctggagaaaggagattatacaattcgactgcaaattcgccatgagcaaatcagtgatttg
gaacgccttaaagaccttccatttattgtttctcatagattgtcaaataccttgagctta
gatattcatgaaaatcatagttttgcacttctagggaagaagaaatcgagcaacttgaca
ttaccacccaaatataaccagccattctttgttacttccttacctgacgataaaatacct
aaaggggcaggacctggatgctatcttgcaggatccttaacattgtcaaagactgaacta
ggaaagaaagctgatgtaatccctgttcattactacttaatacctccaccaacaaagact
aagaatggcagcaaagataaggaaaaagattcagaaaaagagaaagatttgaaagaagag
tttactgaagcgttacgagatcttaaaattcagtggatgacaaagctggattctagtgac
atttataacgaattgaaagaaacatatcctaattatcttcctctgtacgttgctcgactt
catcaattggatgctgaaaaggaacgaatgaaaagacttaatgaaattgttgatgcggca
aatgctgttatttctcatatagatcaaacagccctagcagtttatattgcaatgaagact
gatcccaggcctgatgcagctactataaaaaatgacatggacaaacaaaaatccaccctc
gtagatgccctttgtaggaaaggttgtgccctggcagaccatcttcttcacacccaggct
caagatggagccatttccactgatgcagaaggaaaggaggaagaaggagaaagtcctttg
gattctctggcagaaacattttgggaaactactaaatggactgatctttttgacaataag
gttttgacatttgcatataaacatgcattagtaaataaaatgtatgggagaggccttaaa
tttgcaactaaacttgtggaagaaaaaccaacaaaagaaaactggaaaaattgtattcaa
ctgatgaagttacttggatggacccattgtgcatcttttactgaaaactggctccccatc
atgtatcctcccgattattgcgtattctaa

DBGET integrated database retrieval system