KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654058Help
Entry
104654058         CDS       T03989                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00511  Other glycan degradation
rro00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104654058 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    104654058 (NEU2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     104654058 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-GeneID: 104654058
NCBI-ProteinID: XP_010351439
UniProt: A0A2K6Q5P1
LinkDB All DBs
Position
Un
AA seq 380 aa AA seqDB search
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQTLLAFAEQRASKKDEHAELIVLRRGGYD
ASTHRVQWQAQEVVAQARLGGHRSMNPCPLYDVQTGTLFLFFIAIPGQVTEQQQLQTRAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYRDWSTFAVGPGHCLQLHDRAQSLVVPAYA
YRNLHPIQRPSPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVEAGEQRVVTLNARSHL
RARIQAQSTSDGLDFQESQLVKKLVEPLPQGCQGSVISFPSPHSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAEYLPQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcatccctccctgtcctgcagaaggagagcgtgttccagtcgggagcccatgcctac
agaatccctgccctgctctacctgcctgggcagcagaccctgctggccttcgcagaacag
cgggcaagcaagaaggatgagcacgcagagctgattgtcctgcgcagaggaggctacgat
gcgtccacccaccgggttcagtggcaagctcaggaggtggtggcccaggcccggctgggt
ggacaccggtccatgaacccatgccccttgtatgatgtgcagacggggaccctcttcctc
ttcttcattgccatccctgggcaagtcacagagcaacagcagctgcagaccagggccaat
gtgacgcggctgtgccaagtaaccagcactgaccacgggaggacctggagctcccccaga
gacctcactgatgcggccatcggcccagcctaccgggactggtccacctttgcggtgggc
ccagggcattgtttgcagctgcacgacagggcccagagcctggtggtgcccgcctatgcc
taccggaaccttcaccccatccaaaggccgagcccctccgccttctgcttcctcagccac
gaccatgggcgcacgtgggcgcgagggcactttgtggcccaggacaccctggagtgccag
gtggccgaagttgaggctggggagcagagggtggtgaccctcaacgcgagaagccacctc
cgagccaggatccaggcccagagcaccagtgacgggcttgatttccaggagtctcagctg
gtgaagaagctggtggagccgctgccccagggctgccaagggagtgtcatcagcttcccc
agcccccactcagggcccggctctccagcccagtggctgctctacactcaccccacacac
tcctggcagagggctgacctgggcgcctacctcaacccacgacctccagcccctgaggcc
tggtcggagccagtactgctggctaagggcagctgtgcctactcagacctccagagcatg
ggcaccggccccgatgggtcccccttgtttgggtgtctgtatgaagccaatgattacgag
gagattgtctttctcatgttcaccctaaagcaagccttcccggctgagtacctgcctcag
tga

DBGET integrated database retrieval system