KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654086
Entry
104654086         CDS       T03989                                 

Gene name
CLCA4
Definition
(RefSeq) calcium-activated chloride channel regulator 4 isoform X1
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04924  Renin secretion
rro04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104654086 (CLCA4)
  09154 Digestive system
   04972 Pancreatic secretion
    104654086 (CLCA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104654086 (CLCA4)
Ion channels [BR:rro04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   104654086 (CLCA4)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_CoxE
Other DBs
NCBI-GeneID: 104654086
NCBI-ProteinID: XP_030769495
LinkDB
Position
12
AA seq 923 aa
MWLLRGFVFLLVLCLLHQSNSSFIRLNNNGFEDIIIVIDPSVPEDEKIIEQIQDMVTTAS
TYLFEATERRFFFKNVSILIPENWKENPQYKRPKHENYKHADVIVAPPTLPGRDEPYTKQ
FTECGEKGEHIHFTPDFLLGKKQNEYGPPGRLFVHEWAHLRWGVFDEYNEDQPFYRAKSN
KIEATRCSAGISGINRVYKCQGGSCITRTCRIDSKTKLYEKDCQFFPDKVQTEKASIMFT
QSIDSVVEFCKEKTHNQEAPSLQNKKCNFRSTWEVISSSEDFNNTIPMVTPPPPPVFSLL
KISQRIVCLVLDKSGSMGSYDRLNQMNQAAKYFLLQIVENGSWVGMVHFDSTATIVNKPI
QIISSDERNTLLAWLPTYASGGTSICSGIKSAFQVIGELRPHLDGSEVVLLTDGEDHTAS
SCIDEVKQSGAIVHFIALGTAAEEAVIEMSKITGGRHFYASGKAQNNGLIDAFGALTSGN
TELSQKSLQLESKGLTLNSNPWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPNGTIM
ENFTVDATSKMAYLSIPGTAKVGTWAYSLQAKANPETLTITVTSRAANSSVPPITLNAKM
NKDINSFPSPMIVYAEILQGFVPVLGANVTAVIESQSGHTEVLELLDNGAGADSFKNDGV
YSRYFTAYTENGSYSLKVWAHGGANTARLSLQPPLNRAAYIPGWVVNGEIEANPPRPEID
EDTQTTLEDFSRTASGGAFVVSQVPKYLLDDLHPPSQITDLDATLQEDEIILTWTAPGDN
FDVGKAQHYIIKISGSILDLRDSFDDALQVNTTDLSPKEANSKEIFAFKPGNISEENATH
IFIAIKSIDKSNLTSKVSNIAQVALFTPQANPDDTYPTPTPTPTPTPTPTTDKSHNSGVN
ISTLVLSVIGSIVIVNIILSTTI
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgtggttactcagaggttttgttttcctcttagttctgtgcctgctgcaccagtcaaat
agttccttcattaggctgaataataatggttttgaagatattatcattgtaatagatcct
agcgtgccagaagatgaaaaaataattgaacaaatacaggatatggtcactacagcttct
acttacctgtttgaagccacagaaagaagattttttttcaaaaatgtatctatattaatt
cctgaaaattggaaggaaaatcctcagtacaaaaggccaaaacatgaaaactataaacat
gctgatgttatagttgcaccacctacgctcccaggtagagatgaaccatacaccaagcag
ttcacagaatgtggagagaaaggcgaacacattcacttcacccctgactttctacttgga
aaaaaacaaaatgaatatggaccaccaggcagactgtttgtccatgagtgggctcacctc
cggtggggagtgtttgatgagtacaatgaagatcagcctttctaccgtgctaagtcaaac
aaaatcgaagcaacaaggtgttccgcaggtatctctggtataaatagagtttataagtgt
caaggaggcagctgtattactagaacatgcagaattgattctaaaacaaaactgtatgaa
aaagattgtcaattctttcctgataaggtgcaaacagagaaagcatccataatgtttacg
caaagtattgattctgttgttgaattctgtaaagaaaaaacccataatcaagaagctcca
agcctacaaaacaaaaagtgcaattttagaagtacatgggaggtgattagcagttctgag
gattttaataacaccatacccatggtgacaccacctcctccacctgtcttctcattgctg
aagatcagtcaaagaattgtgtgcttagttcttgataagtctggaagcatggggagttat
gaccgcctaaatcaaatgaaccaagcagcaaaatatttcctgctgcagattgttgaaaat
ggatcctgggtggggatggttcactttgatagtactgccactattgtaaataagccaatc
caaataataagcagtgatgaaagaaacacactcttggcatggttacctacatacgcttcg
ggaggaacttccatctgctctggaattaaatccgcatttcaggtcattggagagctacgc
ccccacctcgatggatctgaagtagtgctgctgactgatggggaggaccacactgcaagt
tcttgtattgatgaagtgaaacaaagtggggccattgttcattttattgctttgggaaca
gctgctgaagaagcagtaatagagatgagcaagataacaggaggacgtcatttttatgct
tcaggtaaagcccagaacaatggcctcattgatgcttttggggcccttacatcaggaaat
actgaactctcccagaagtcccttcagcttgaaagtaagggattaacactgaacagtaat
ccctggatgaacgacactgtcataattgacagtacagtgggaaaggacacattctttctc
atcacatggaacagtctgcctcccagtatttctctctgggatcccaatggaacaatcatg
gaaaatttcacagtggatgcaacttccaaaatggcctatctcagtattccaggaactgca
aaggtgggcacttgggcctacagtcttcaagccaaagcaaacccagaaacattaactatc
acagtaacttctcgagcagcaaattcttctgtgcctccaatcacattgaatgctaaaatg
aataaggacataaacagtttccccagcccaatgattgtttacgcagaaattctacaaggg
tttgtacctgttcttggagccaatgtgactgctgtcattgaatcacagagtggacataca
gaagttttggagcttttggataatggtgcaggcgctgattctttcaagaatgatggggtc
tactccaggtattttacagcatatacagaaaatggcagctacagcttaaaagtatgggct
catggaggagcaaacactgccaggctaagcttacagcctccactgaatagagccgcgtat
ataccaggctgggtagtgaacggggaaattgaagcaaacccgccaagacctgaaattgat
gaggatactcagaccaccttggaggatttcagccgaacagcgtctggaggtgcatttgtg
gtgtcacaagtcccaaaatatttattggatgacctacatccaccaagtcaaatcacagac
cttgatgccacacttcaggaggatgagattattcttacatggacagcaccaggagataac
tttgatgttgggaaagctcaacattatatcataaaaataagtggaagtattcttgatcta
agagacagttttgatgatgctcttcaagtaaatactactgatctgtcaccaaaggaggcc
aactccaaggaaatctttgcatttaaaccagggaatatctcagaagaaaatgcaactcac
atatttattgccattaaaagcatagataaaagcaatttgacatcaaaagtatccaacatt
gcacaagtagctttgtttacccctcaagcaaatcctgatgacacttatcctactcctact
cctacccctacccctactcctactcctactactgataaaagtcataattctggagttaat
atttctaccctggtattgtctgtgattgggtctattgtaattgttaacattattttaagt
accaccatttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654088
Entry
104654088         CDS       T03989                                 

Definition
(RefSeq) calcium-activated chloride channel regulator 1-like isoform X1
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04924  Renin secretion
rro04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104654088
  09154 Digestive system
   04972 Pancreatic secretion
    104654088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104654088
Ion channels [BR:rro04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   104654088
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_3 MG2 VWA_CoxE Peptidase_C39
Other DBs
NCBI-GeneID: 104654088
NCBI-ProteinID: XP_010351468
UniProt: A0A2K6QRV3
LinkDB
Position
12
AA seq 903 aa
MVFSLKVILFPSLLLLPVLKSSQVTLNNNGYDGIVIAINPSVPEDEKLIQNIKEMVIEAS
AYLFHATKRRVYFRNVSILIPMTWKSKSEYLIPKQESYDQADVLVADPNLKYGDDPYTLQ
YGQCGDKGQYIHFTPNFLLTNNLPTYGPRGRVFVHEWAHLRWGVFDEYNVDQPFYISRRN
TIEATRCSTHITGVNMVLHECKGGSCIERPCRRNPKTGLYEAKCTFIPNRSQTAKESIMF
MQNLDSVTEFCTEKTHNKEAPNLQNKMCNHRSTWDVIMSSEDFQHLSPMTEINSPPRPTF
SLLKSKQRVVCLVLDKSGSMYREDRLFRMNQAAELYLIQIIEKGSLVGMVTFDSFAKIQN
NLTKIIDENTYQKIIANLPQEANGGTSICGGLKAGFQAISQSNQSTSGSEIILLTDGEDK
QMSLCFEEVKQSGAIIHTIALGPSADKELETLSYMTRGHRFYAHKDINGLIDAFSRISSR
SGNISQQALQLESKTLNIPGKKWINGTVPVDSTVGNDTFFVVTWTIQKPEIILQDPKGKK
YTTSDFQEDKLNIRSVRLRIPGIAETGTWTYSLRNNHTKSQLLTVTMTTRARSPTTLPVI
ATAHISQNTAPYPSPMIVYARVSQGFLPVLGINVTAIIENEDGHQVTFELWDNGAGADTV
KNDGIYSRYFTDYHGNGRYSLKVHAQARKNTARLSQQQNKALYIPGYAENGKIIPNPPKP
EVKEDVAEPQIDDFSRLASGGSFSISVVPPNGNHSQVFPPGKIVDLDAKFQGDRIQLSWT
APGKVLDKGRADSYMIRISKHVLDLQENFDKAALINTSGLIPKEAGSVENFEFKPEPSKI
ENGTTFYIAIQAIREPNVTSEVSNIAQATNFIPPQEPSIPDLGTNISAISLAIFGLAVIV
SIF
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggtgttcagtctgaaggtgattctcttcccatccttgcttctcttgcctgtattgaaa
agctcgcaggtaactttaaataacaatggatatgatggcattgtcattgcaattaatccc
agtgtaccagaagatgaaaaactcattcaaaacataaaggaaatggtaattgaagcatct
gcttacctgtttcatgccaccaaacgaagagtttatttcaggaatgtaagcattttaatt
ccaatgacctggaaatcaaaatctgagtacttaatcccaaaacaagaatcatatgaccag
gcagatgtcttagttgctgatcctaacctgaaatacggagatgatccctatacacttcaa
tatggacaatgtggagataaaggacaatatatacattttactccaaacttcttgttgact
aataatttgcctacttatgggcctcgaggtagagtatttgtccatgagtgggcccatctc
cggtggggagtatttgatgagtataatgtggaccaaccattctatatttccagaagaaac
actattgaagcaacaagatgttccactcatattactggtgttaacatggttttgcacgaa
tgcaagggcggcagctgtatagaacgaccatgcagacgtaacccaaagacggggctgtat
gaagcaaaatgtacatttatcccaaacagatcccagactgccaaggaatccattatgttt
atgcaaaatcttgattctgtgactgagttttgtactgaaaaaacacacaataaagaagct
ccaaacctacagaacaaaatgtgcaatcacaggagcacatgggatgtaatcatgagctct
gaagattttcagcatttatctcccatgacagaaataaattcaccacctcgtcctacattt
tcattgctcaagtccaaacagcgtgtagtctgtttggtacttgataaatctggaagcatg
tatagagaagaccgtctctttcgaatgaatcaagcagcagaactgtacttgattcaaatt
attgaaaagggatccttggttgggatggtcacatttgacagttttgctaaaatccaaaat
aatctcacaaaaataattgatgagaacacttaccaaaagatcattgcaaacctgcctcaa
gaagctaatggcggcacttcaatttgtgggggactcaaagcaggatttcaggcaatttcc
cagagtaatcagagtacttcgggttctgaaatcatattactaacagatggggaagataaa
caaatgagcttatgctttgaagaggtaaaacaaagtggtgcgatcatccacaccattgct
ctggggccgtctgctgacaaagaactggagaccctgtcatatatgacaagaggacatcgc
ttttatgcccataaggacataaatggccttattgatgctttcagcagaatttcatctaga
agtggcaacatctctcagcaggctcttcagttggaaagtaaaaccttgaatatcccaggg
aagaaatggataaatggtacagtgcctgtggatagtacagttggaaatgatactttcttt
gttgtcacatggacaattcaaaagccagaaataattcttcaagatccaaaaggaaaaaaa
tatactacctcagatttccaagaagataaactaaatattcggtctgtccgtcttcgaata
ccaggtattgcagagacaggcacttggacttacagccttcgaaataatcataccaaatct
caattgctaactgtgacaatgaccactcgagcaagaagccctaccacactcccagtaatt
gcaactgctcacataagtcaaaatacagctccttaccctagcccaatgattgtttatgca
cgagtcagtcaagggtttctgcctgttctgggaatcaacgtaacagccattatagaaaat
gaagacggacatcaagtaacatttgagctctgggacaatggtgcaggtgctgatactgtc
aagaatgatggcatctactcaaggtattttacagattaccatggaaatggtagatacagt
ttaaaagtgcatgcccaggcaagaaaaaacacagctaggctaagtcaacaacagaataaa
gctctgtatataccgggctatgctgaaaatggaaaaattataccgaacccacccaaacct
gaagtcaaagaagatgtggcagaacctcaaatagacgacttcagcagactcgcctctgga
gggtcctttagtatatcagtagtgccgcctaatggtaatcattctcaggtgttcccacct
ggtaaaattgtagacctggatgctaagtttcaaggagatcgtattcaactttcatggact
gcccctggcaaggtcctcgataaaggaagagctgacagctacatgataagaataagcaaa
catgtcctggacctccaagaaaattttgataaagctgctttaataaatacttctggtctg
atacctaaggaggctggctcagtagaaaattttgaatttaaaccagaaccttctaaaata
gagaatggtaccacattctatattgcaattcaagccatccgtgaacccaatgtcacctca
gaggtttcaaacattgcacaagcaactaactttattcctccacaggaacccagcattccc
gatctgggtaccaatatttctgcaatcagtttggcaatttttggattagctgtaattgta
tccatattttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682225
Entry
104682225         CDS       T03989                                 

Gene name
CLCA1
Definition
(RefSeq) calcium-activated chloride channel regulator 1
  KO
K05027  calcium-activated chloride channel regulator 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04924  Renin secretion
rro04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104682225 (CLCA1)
  09154 Digestive system
   04972 Pancreatic secretion
    104682225 (CLCA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104682225 (CLCA1)
Ion channels [BR:rro04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   104682225 (CLCA1)
SSDB
Motif
Pfam: CLCA VWA_2 VWA VWA_CoxE DUF444
Other DBs
NCBI-GeneID: 104682225
NCBI-ProteinID: XP_010387078
UniProt: A0A2K6NXP8
LinkDB
Position
12
AA seq 913 aa
MGPFKGSVFILILHLLEGALSNSLIQLNNNGYEGIVIAIDPNVPEDETLIQQIKDMVTQA
SPYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAEPTPPDDDEPYTE
HIGKCGDKGERIHLTPNFIAGKKLNEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNG
RIQAVRCSVGITGKTEVKKCQGGSCYSKKCTFNKATGLYEKGCEFIPYSSQTQKASIMFA
QHVGSVVEFCTEQNHNKEAPNMQNTKCSLRSTWEVIRDSEDFKKTTPTTTQPPNPTFSLL
QIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQIIELRSWVGMVTFDSAARVQSELI
QINSGSDRDTLTKSLPTAASGGTSICSGLRSAFTVIKKKYPTDGSEIVLLTDGEDNSISG
CFNEVKQSGAIIHTVALGPSAARELEELSKMTGGLQTYASDQVQNNGLIDAFGALSSGNG
AVSQRSIQLESKGSTLQNSQWMNGTVIVDSTVGKDTLFLITWTTQPPQILLWDPSGQKQE
GFVVDKNTKMAFLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKMNKD
TGKFPSPMLVYANIRQGASPILRASVTALIESENGKTVTLELLDNGAGADAAKDDGVYSR
YFTTYDTNGRYSVKVRALGGVNAVRRRAIPQQSGVMYIPGWIQNDEIQWNPPRPEIEENV
QHKQVCFSRTSSGGSFVASGVPNAPIPDLFPPCQITDLKAEIHGGSLINLTWTAPGDDYD
HGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDLF
IAIQAVDKVDLKSEISNIARVSLFIPPQTLPETPSPDETSAPCPNISINSTIPGIHILKI
MWKWIGELQLSIG
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggggccatttaagggttctgtgttcatcctgattcttcaccttctagaaggggccctg
agtaattcactcattcagctgaacaacaatggctatgaaggcattgtcattgcaatcgac
cccaatgtgccagaagatgaaacactcattcaacaaataaaagacatggtgacgcaggca
tctccatacctgtttgaagctacaggaaaacgattttatttcaaaaatgttgccattttg
attccggaaacatggaagacaaaagctgactatgtgagaccaaaactcgagacctacaaa
aatgctgatgttctggttgctgagcctactcctccagatgatgatgaaccctacactgag
cacataggcaagtgtggagacaagggtgaaaggatccacctcactcctaatttcatagca
ggaaaaaagttaaatgaatatggaccacaaggtagggcatttgtccatgagtgggctcat
ctacgatggggagtatttgatgagtacaataatgatgagaaattctacttatccaatgga
agaatccaagcagtaagatgttcagtaggtattactggtaaaactgaagtaaagaagtgt
cagggaggcagctgttacagcaaaaaatgcacattcaataaagcaacaggactctacgaa
aaaggatgtgagtttataccctattcctcacagacccagaaggcttctataatgtttgca
caacatgttggttctgtagttgaattctgtacagaacaaaaccataacaaagaagctcca
aacatgcaaaatacaaaatgcagtctccgaagcacatgggaagtgatccgtgattctgag
gactttaagaaaaccactcctacgacaacacagccacccaatcccaccttctcattgctg
cagattggacaaagaattgtgtgtttagtccttgataaatctggaagcatggcgactggt
aaccgcctcaatcgactgaatcaagcaggccagcttttcctgctgcagataattgagctg
cggtcctgggttgggatggtgacatttgacagtgctgcccgtgtacaaagtgaactcata
cagataaacagtggcagtgacagggacacactcaccaaaagtttacctacagcagcttca
ggagggacgtccatctgctccgggcttcgatcggcatttactgtgattaagaagaaatat
ccaactgatggatctgaaattgtgctgctgacggatggggaagacaactctataagcggg
tgctttaacgaggtcaaacaaagtggtgccatcatccacacagtcgccttggggccctct
gcggctcgagaactagaggaactgtccaaaatgacaggaggtttacagacatatgcttca
gatcaagttcagaacaatggcctcattgatgcttttggagccctttcatcaggaaatgga
gctgtctctcagcgctccatccagcttgagagtaagggatcaaccctccagaacagccag
tggatgaatggcacagtgatcgtggacagcacagtgggaaaggacactttgtttcttatc
acctggacaacacagcctccccaaatccttctctgggatcccagtggacagaagcaagaa
ggctttgtagtggacaaaaacaccaaaatggccttcctccaaatcccaggcattgctaag
gttggcacctggaaatacagtctgcaagcaagctcacaaaccttgactctgactgtcaca
tcccgtgcatccaatgctaccctgcctccaattacagtgacttccaaaatgaacaaggac
actggcaaattccccagccctatgttagtttatgcaaatattcgccaaggagcctctcca
attctcagggccagtgtcacagccctgattgaatcagagaatggaaaaacagttaccttg
gaactactggataatggagcaggtgctgatgctgctaaggatgacggtgtctactcaagg
tatttcacaacttacgacacgaatggtagatacagtgtaaaagtgcgggctctgggagga
gtcaacgcagtcagacggagagcaataccccagcagagtggagtaatgtacatacctggc
tggattcagaatgatgaaatacaatggaatccaccaagacctgaaattgaggaaaatgtt
caacacaagcaagtatgtttcagcagaacatcctcgggaggctcatttgtggcttctggt
gtcccaaatgctcccatacctgatctcttcccaccttgccaaatcaccgacctgaaggcg
gaaattcacgggggcagtctcattaatctgacttggacagctcctggggatgattatgac
catggaacagctcacaagtatatcattcgaataagtacaagtattcttgatctcagagat
aagttcaatgaatctcttcaagtgaatactactgctctcatcccaaaggaagccaactct
gaggaagtctttttgtttaaaccagaaaacattacttttgaaaatggcacagatcttttc
attgctattcaagctgttgataaggtcgatctaaaatcagaaatatccaacattgcacga
gtatctttgtttattcctccacagactctgccagagacacctagtcctgatgaaacgtct
gctccttgtcctaatattagtatcaacagcaccattcctggcattcacattttaaaaatt
atgtggaagtggataggagaactgcagctgtcaataggctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682226
Entry
104682226         CDS       T03989                                 

Gene name
CLCA2
Definition
(RefSeq) calcium-activated chloride channel regulator 2 isoform X1
  KO
K05028  calcium-activated chloride channel regulator 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04924  Renin secretion
rro04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104682226 (CLCA2)
  09154 Digestive system
   04972 Pancreatic secretion
    104682226 (CLCA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104682226 (CLCA2)
Ion channels [BR:rro04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   104682226 (CLCA2)
SSDB
Motif
Pfam: CLCA VWA_2 SusE
Other DBs
NCBI-GeneID: 104682226
NCBI-ProteinID: XP_010387079
LinkDB
Position
12
AA seq 948 aa
MTQRGIAGPVCNLKFVTLLVALSSELLFLGAGVQLQDNGYNGLLIAINPQVPENQNLISN
IKEMITEASFYLFNATKRRVFFRDIKILIPATWKANNYSKIKQESYEKANVIVTDWHGAH
GDDPYTLQYRGCGKGGKYIHFTPNFLLNDNLTAGYGSRALSSTGRVFVHEWAHLRWGVFD
EYNNDKPFYINGRNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCTFIYNSTQN
ATASIMFMQSLSSVVEFCNASTHNQEAPNLQNRMCSLRSAWDVITDSADFHHSFPMNGTE
LPPPPTFSLVQAGDKVVCLVLDVSSKMAEADRLLLLQQAAEFYLMQIVEIHTFVGIASFD
SKGEVRAQLHQINSNDDRKLLVSYLPTTVSAKTEVSICSGLKKGFEVVEKLNGKAYGTVM
VLVTSGDDKLIGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNS
MIDAFSRISSGTGDVFQQRIQLESTGENVKPHHQLKNTVTVDSTVGNDTIFLVTWQTSGP
PEIMLFDPDGRKYYTDNFITNLTFRTASLWIPGTAKPGHWTYTLNNTHHSLQALKVAVTS
RASNSAVPPATVEAFVERDSLHFPQPVMIYANVRQGFYPILNATVTATVEPETGDPVTLR
LLDDGAGADVIKNDGIYSRYFFSFAVNGRYSLKVHVNHSPSISTLAHSIPGSHAMYVPGY
TANGNIQMNAPRKSVGRNGEEQKWGFSRVSSGGSFSVLGVPAGPHPDIFPPCKIIDLEAV
NVEEELTLSWTAPGEDFDQGQATSYEIRMSKSLENIQDDFNNAILVNTSKRNPQQAGIRE
IFTFSPQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLKSAISNIAQASLFTPPNSDPV
PARDYLILKGVLTAMGLIGIICLIIVVTHHTLNRKKRADKKENGTKLL
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgacccaaagaggcattgcaggtcctgtttgcaacctgaagtttgtgactctcctggtt
gccctaagttcagaacttctatttctgggagctggagtacaacttcaagacaatgggtat
aatggattgctcattgcaattaatcctcaggtacctgagaatcagaacctcatctcaaac
attaaggaaatgataactgaagcttcattttacctatttaatgctaccaagagaagagta
tttttcagagatataaagattttaatacctgccacatggaaagctaataattacagcaaa
ataaaacaagaatcatatgaaaaggcaaatgtcatagtaactgactggcatggggcacat
ggagatgatccatacaccctgcagtacagaggatgtggaaaagggggaaaatacattcat
ttcacacctaatttcctactgaatgataacttaacagctggctacggatcacgagctctt
tcttccacaggccgagtgtttgtccacgaatgggcccatctccgttggggtgtatttgat
gagtataacaatgacaaacctttctatataaatgggcgaaatcaaattaaagtgacaagg
tgttcatctgacatcacaggcatttttgtgtgtgaaaaaggtccttgcccccaagaaaac
tgtattattagtaagctttttaaagaaggatgcacctttatctacaatagcacccaaaat
gcaactgcatcaataatgttcatgcaaagtttatcttctgtggttgaattttgtaatgca
agtacccacaaccaagaagcaccaaacctacagaaccggatgtgcagcctcagaagtgca
tgggatgtaatcacagactccgctgactttcaccacagctttcccatgaatgggactgag
cttccacctcctcccacattctcgcttgtacaggctggtgacaaagtggtctgtttagtg
ctggatgtgtccagcaagatggcagaggctgacagactccttctactacaacaagccgca
gaattttatttgatgcagattgttgaaattcataccttcgtgggcattgccagtttcgat
agcaaaggagaggtcagagctcagctacatcaaattaacagcaatgatgatcgaaagttg
ctggtttcatatctgcccaccactgtatcagctaaaacagaagtcagcatttgttcaggg
cttaagaaaggatttgaggtggttgaaaaactgaatggaaaagcttatggcactgtgatg
gtattagtgaccagtggagacgataagcttattggcaattgcttacccactgtgctcagc
agtggttcaacaattcactccattgccctgggttcatctgcagccccaaatctggaggaa
ttatcacgtcttacaggaggtttaaagttctttgttccagatatatcaaactccaatagc
atgattgatgctttcagtagaatttcctctggaactggagacgttttccagcaacgtatt
cagcttgaaagcacaggtgaaaatgttaaacctcaccatcaattgaaaaacacagtgact
gtggatagcactgtcggcaatgacactatctttctagttacgtggcagacaagtggtcct
cctgagattatgttatttgatcctgatggaagaaaatactacacagataattttatcacc
aatctaacttttcggacagctagtctttggattccaggaacagctaagcctgggcactgg
acttacacactgaacaatacccaccattctctgcaagccctgaaagtggcagtgacctct
cgtgcctccaactcagctgtgcccccagccactgtggaagcctttgtggaaagagacagc
ctccattttccccagcccgtgatgatttatgccaatgtgagacagggattctatcccatt
cttaatgccactgtcactgccacagttgagccagagactggagatcctgttacactgaga
cttctcgatgatggagcaggtgctgatgttataaaaaatgatggaatttactcgaggtat
tttttctcctttgctgtaaatggtagatatagcttgaaagtgcatgtcaatcactctcca
agcataagcacactagcccactctattccagggagtcatgctatgtatgtaccaggttac
acagcaaacggtaatattcagatgaatgctccaaggaaatcagtaggcagaaatggggag
gagcaaaaatggggctttagccgagtcagctcaggaggctccttttcagtgctgggagtt
ccagctggcccccaccctgatatctttccaccatgcaaaattattgacctggaagctgta
aacgtagaagaggaattgaccctatcttggacagcacctggagaagactttgatcagggc
caggctacaagctatgaaataagaatgagtaaaagtctagagaatatccaagatgacttt
aacaatgcaattttagtaaatacatcaaagcgaaatcctcagcaagctggcatcagggag
atatttacgttctcacctcaaatttccacaaatggacctgaacatcagccaaatggagaa
acacatgaaagccacagaatttatgttgcaatacgagcaatggataggaactccttaaag
tctgctatatctaacattgcccaggcatctctgtttactccccccaattctgatcctgta
cctgccagagattatcttatattgaaaggagttttaacagcaatgggtttgataggaatc
atttgccttattatagttgtgacacatcatactttaaacagaaaaaagagagcagacaag
aaagagaatggaacaaaattattataa

DBGET integrated database retrieval system