KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654186
Entry
104654186         CDS       T03989                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104654186 (AKT3)
   04012 ErbB signaling pathway
    104654186 (AKT3)
   04014 Ras signaling pathway
    104654186 (AKT3)
   04015 Rap1 signaling pathway
    104654186 (AKT3)
   04370 VEGF signaling pathway
    104654186 (AKT3)
   04371 Apelin signaling pathway
    104654186 (AKT3)
   04630 JAK-STAT signaling pathway
    104654186 (AKT3)
   04668 TNF signaling pathway
    104654186 (AKT3)
   04066 HIF-1 signaling pathway
    104654186 (AKT3)
   04068 FoxO signaling pathway
    104654186 (AKT3)
   04072 Phospholipase D signaling pathway
    104654186 (AKT3)
   04071 Sphingolipid signaling pathway
    104654186 (AKT3)
   04024 cAMP signaling pathway
    104654186 (AKT3)
   04022 cGMP-PKG signaling pathway
    104654186 (AKT3)
   04151 PI3K-Akt signaling pathway
    104654186 (AKT3)
   04152 AMPK signaling pathway
    104654186 (AKT3)
   04150 mTOR signaling pathway
    104654186 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104654186 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    104654186 (AKT3)
   04218 Cellular senescence
    104654186 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104654186 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    104654186 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104654186 (AKT3)
   04613 Neutrophil extracellular trap formation
    104654186 (AKT3)
   04620 Toll-like receptor signaling pathway
    104654186 (AKT3)
   04625 C-type lectin receptor signaling pathway
    104654186 (AKT3)
   04660 T cell receptor signaling pathway
    104654186 (AKT3)
   04662 B cell receptor signaling pathway
    104654186 (AKT3)
   04664 Fc epsilon RI signaling pathway
    104654186 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    104654186 (AKT3)
   04062 Chemokine signaling pathway
    104654186 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104654186 (AKT3)
   04922 Glucagon signaling pathway
    104654186 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    104654186 (AKT3)
   04920 Adipocytokine signaling pathway
    104654186 (AKT3)
   04929 GnRH secretion
    104654186 (AKT3)
   04915 Estrogen signaling pathway
    104654186 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    104654186 (AKT3)
   04917 Prolactin signaling pathway
    104654186 (AKT3)
   04926 Relaxin signaling pathway
    104654186 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    104654186 (AKT3)
   04919 Thyroid hormone signaling pathway
    104654186 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104654186 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104654186 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    104654186 (AKT3)
   04728 Dopaminergic synapse
    104654186 (AKT3)
   04722 Neurotrophin signaling pathway
    104654186 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104654186 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    104654186 (AKT3)
   04213 Longevity regulating pathway - multiple species
    104654186 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654186 (AKT3)
   05205 Proteoglycans in cancer
    104654186 (AKT3)
   05230 Central carbon metabolism in cancer
    104654186 (AKT3)
   05231 Choline metabolism in cancer
    104654186 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104654186 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104654186 (AKT3)
   05212 Pancreatic cancer
    104654186 (AKT3)
   05225 Hepatocellular carcinoma
    104654186 (AKT3)
   05226 Gastric cancer
    104654186 (AKT3)
   05214 Glioma
    104654186 (AKT3)
   05221 Acute myeloid leukemia
    104654186 (AKT3)
   05220 Chronic myeloid leukemia
    104654186 (AKT3)
   05218 Melanoma
    104654186 (AKT3)
   05211 Renal cell carcinoma
    104654186 (AKT3)
   05215 Prostate cancer
    104654186 (AKT3)
   05213 Endometrial cancer
    104654186 (AKT3)
   05224 Breast cancer
    104654186 (AKT3)
   05222 Small cell lung cancer
    104654186 (AKT3)
   05223 Non-small cell lung cancer
    104654186 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104654186 (AKT3)
   05017 Spinocerebellar ataxia
    104654186 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104654186 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104654186 (AKT3)
   04931 Insulin resistance
    104654186 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104654186 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104654186 (AKT3)
   05135 Yersinia infection
    104654186 (AKT3)
   05152 Tuberculosis
    104654186 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104654186 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    104654186 (AKT3)
   05161 Hepatitis B
    104654186 (AKT3)
   05160 Hepatitis C
    104654186 (AKT3)
   05164 Influenza A
    104654186 (AKT3)
   05162 Measles
    104654186 (AKT3)
   05168 Herpes simplex virus 1 infection
    104654186 (AKT3)
   05163 Human cytomegalovirus infection
    104654186 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104654186 (AKT3)
   05169 Epstein-Barr virus infection
    104654186 (AKT3)
   05165 Human papillomavirus infection
    104654186 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104654186 (AKT3)
   05142 Chagas disease
    104654186 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104654186 (AKT3)
   01524 Platinum drug resistance
    104654186 (AKT3)
   01522 Endocrine resistance
    104654186 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104654186 (AKT3)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104654186 (AKT3)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   104654186 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 104654186
NCBI-ProteinID: XP_030791601
LinkDB
Position
8
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagacactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcggacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcagttttcctactctgcaagtggacgagaataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673041
Entry
104673041         CDS       T03989                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104673041 (AKT1)
   04012 ErbB signaling pathway
    104673041 (AKT1)
   04014 Ras signaling pathway
    104673041 (AKT1)
   04015 Rap1 signaling pathway
    104673041 (AKT1)
   04370 VEGF signaling pathway
    104673041 (AKT1)
   04371 Apelin signaling pathway
    104673041 (AKT1)
   04630 JAK-STAT signaling pathway
    104673041 (AKT1)
   04668 TNF signaling pathway
    104673041 (AKT1)
   04066 HIF-1 signaling pathway
    104673041 (AKT1)
   04068 FoxO signaling pathway
    104673041 (AKT1)
   04072 Phospholipase D signaling pathway
    104673041 (AKT1)
   04071 Sphingolipid signaling pathway
    104673041 (AKT1)
   04024 cAMP signaling pathway
    104673041 (AKT1)
   04022 cGMP-PKG signaling pathway
    104673041 (AKT1)
   04151 PI3K-Akt signaling pathway
    104673041 (AKT1)
   04152 AMPK signaling pathway
    104673041 (AKT1)
   04150 mTOR signaling pathway
    104673041 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104673041 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    104673041 (AKT1)
   04218 Cellular senescence
    104673041 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104673041 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104673041 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104673041 (AKT1)
   04613 Neutrophil extracellular trap formation
    104673041 (AKT1)
   04620 Toll-like receptor signaling pathway
    104673041 (AKT1)
   04625 C-type lectin receptor signaling pathway
    104673041 (AKT1)
   04660 T cell receptor signaling pathway
    104673041 (AKT1)
   04662 B cell receptor signaling pathway
    104673041 (AKT1)
   04664 Fc epsilon RI signaling pathway
    104673041 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    104673041 (AKT1)
   04062 Chemokine signaling pathway
    104673041 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104673041 (AKT1)
   04922 Glucagon signaling pathway
    104673041 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    104673041 (AKT1)
   04920 Adipocytokine signaling pathway
    104673041 (AKT1)
   04929 GnRH secretion
    104673041 (AKT1)
   04915 Estrogen signaling pathway
    104673041 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    104673041 (AKT1)
   04917 Prolactin signaling pathway
    104673041 (AKT1)
   04926 Relaxin signaling pathway
    104673041 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    104673041 (AKT1)
   04919 Thyroid hormone signaling pathway
    104673041 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104673041 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104673041 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    104673041 (AKT1)
   04728 Dopaminergic synapse
    104673041 (AKT1)
   04722 Neurotrophin signaling pathway
    104673041 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104673041 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    104673041 (AKT1)
   04213 Longevity regulating pathway - multiple species
    104673041 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673041 (AKT1)
   05205 Proteoglycans in cancer
    104673041 (AKT1)
   05230 Central carbon metabolism in cancer
    104673041 (AKT1)
   05231 Choline metabolism in cancer
    104673041 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104673041 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104673041 (AKT1)
   05212 Pancreatic cancer
    104673041 (AKT1)
   05225 Hepatocellular carcinoma
    104673041 (AKT1)
   05226 Gastric cancer
    104673041 (AKT1)
   05214 Glioma
    104673041 (AKT1)
   05221 Acute myeloid leukemia
    104673041 (AKT1)
   05220 Chronic myeloid leukemia
    104673041 (AKT1)
   05218 Melanoma
    104673041 (AKT1)
   05211 Renal cell carcinoma
    104673041 (AKT1)
   05215 Prostate cancer
    104673041 (AKT1)
   05213 Endometrial cancer
    104673041 (AKT1)
   05224 Breast cancer
    104673041 (AKT1)
   05222 Small cell lung cancer
    104673041 (AKT1)
   05223 Non-small cell lung cancer
    104673041 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104673041 (AKT1)
   05017 Spinocerebellar ataxia
    104673041 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104673041 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104673041 (AKT1)
   04931 Insulin resistance
    104673041 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104673041 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104673041 (AKT1)
   05135 Yersinia infection
    104673041 (AKT1)
   05152 Tuberculosis
    104673041 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104673041 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    104673041 (AKT1)
   05161 Hepatitis B
    104673041 (AKT1)
   05160 Hepatitis C
    104673041 (AKT1)
   05164 Influenza A
    104673041 (AKT1)
   05162 Measles
    104673041 (AKT1)
   05168 Herpes simplex virus 1 infection
    104673041 (AKT1)
   05163 Human cytomegalovirus infection
    104673041 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104673041 (AKT1)
   05169 Epstein-Barr virus infection
    104673041 (AKT1)
   05165 Human papillomavirus infection
    104673041 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104673041 (AKT1)
   05142 Chagas disease
    104673041 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104673041 (AKT1)
   01524 Platinum drug resistance
    104673041 (AKT1)
   01522 Endocrine resistance
    104673041 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104673041 (AKT1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104673041 (AKT1)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   104673041 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 104673041
NCBI-ProteinID: XP_030786406
LinkDB
Position
5
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKHEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMRHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagtgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcgaccacgctacttcctcctcaagaacgatggcactttcattggctataaggag
cggccgcaggacgtggaccaacgtgaggcccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacagagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccacgtggagactcccgaggagcgggaggagtggaca
accgccatccagacagtggccgatggcctcaagaagcacgaggaggagatgatggacttc
cggtcgggctcacccagcgacaactcaggggctgaagagatggaggtgtccctggccaaa
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcgggaaggtgatcctggtgaaggagaaggcaacgggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgt
gttctacagaactccaggcaccccttcctcacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaatgggggcgagctcttcttccacctgtcc
cgggagcgtgtgttctctgaggaccgggcccgcttctatggcgctgagatcgtgtcagcc
ctggactacctgcactcggagaagaatgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggcgccaccatgaagaccttttgcggcacacccgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcggtggactggtgggggctgggcgtggtcatgtat
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctttttgagctc
atcctcatggaggagatccgcttcccacgcacgcttggtcctgaggccaagtccttgctc
tcagggctgctcaagaaggaccctaagcagaggcttggcgggggctctgaggacgccaag
gagatcatgcggcatcgcttctttgccggcatcgtgtggcagcacgtgtatgagaagaag
ctcagcccacccttcaagccccaggtcacatcggagaccgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagatgacagcatggagtgc
gtggacagcgagcgcaggccccactttccccagttctcctactcggccagcggcacggcc
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676121
Entry
104676121         CDS       T03989                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104676121 (AKT2)
   04012 ErbB signaling pathway
    104676121 (AKT2)
   04014 Ras signaling pathway
    104676121 (AKT2)
   04015 Rap1 signaling pathway
    104676121 (AKT2)
   04370 VEGF signaling pathway
    104676121 (AKT2)
   04371 Apelin signaling pathway
    104676121 (AKT2)
   04630 JAK-STAT signaling pathway
    104676121 (AKT2)
   04668 TNF signaling pathway
    104676121 (AKT2)
   04066 HIF-1 signaling pathway
    104676121 (AKT2)
   04068 FoxO signaling pathway
    104676121 (AKT2)
   04072 Phospholipase D signaling pathway
    104676121 (AKT2)
   04071 Sphingolipid signaling pathway
    104676121 (AKT2)
   04024 cAMP signaling pathway
    104676121 (AKT2)
   04022 cGMP-PKG signaling pathway
    104676121 (AKT2)
   04151 PI3K-Akt signaling pathway
    104676121 (AKT2)
   04152 AMPK signaling pathway
    104676121 (AKT2)
   04150 mTOR signaling pathway
    104676121 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104676121 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    104676121 (AKT2)
   04218 Cellular senescence
    104676121 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104676121 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    104676121 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104676121 (AKT2)
   04613 Neutrophil extracellular trap formation
    104676121 (AKT2)
   04620 Toll-like receptor signaling pathway
    104676121 (AKT2)
   04625 C-type lectin receptor signaling pathway
    104676121 (AKT2)
   04660 T cell receptor signaling pathway
    104676121 (AKT2)
   04662 B cell receptor signaling pathway
    104676121 (AKT2)
   04664 Fc epsilon RI signaling pathway
    104676121 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    104676121 (AKT2)
   04062 Chemokine signaling pathway
    104676121 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104676121 (AKT2)
   04922 Glucagon signaling pathway
    104676121 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    104676121 (AKT2)
   04920 Adipocytokine signaling pathway
    104676121 (AKT2)
   04929 GnRH secretion
    104676121 (AKT2)
   04915 Estrogen signaling pathway
    104676121 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    104676121 (AKT2)
   04917 Prolactin signaling pathway
    104676121 (AKT2)
   04926 Relaxin signaling pathway
    104676121 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    104676121 (AKT2)
   04919 Thyroid hormone signaling pathway
    104676121 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104676121 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104676121 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    104676121 (AKT2)
   04728 Dopaminergic synapse
    104676121 (AKT2)
   04722 Neurotrophin signaling pathway
    104676121 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104676121 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    104676121 (AKT2)
   04213 Longevity regulating pathway - multiple species
    104676121 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676121 (AKT2)
   05205 Proteoglycans in cancer
    104676121 (AKT2)
   05230 Central carbon metabolism in cancer
    104676121 (AKT2)
   05231 Choline metabolism in cancer
    104676121 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104676121 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104676121 (AKT2)
   05212 Pancreatic cancer
    104676121 (AKT2)
   05225 Hepatocellular carcinoma
    104676121 (AKT2)
   05226 Gastric cancer
    104676121 (AKT2)
   05214 Glioma
    104676121 (AKT2)
   05221 Acute myeloid leukemia
    104676121 (AKT2)
   05220 Chronic myeloid leukemia
    104676121 (AKT2)
   05218 Melanoma
    104676121 (AKT2)
   05211 Renal cell carcinoma
    104676121 (AKT2)
   05215 Prostate cancer
    104676121 (AKT2)
   05213 Endometrial cancer
    104676121 (AKT2)
   05224 Breast cancer
    104676121 (AKT2)
   05222 Small cell lung cancer
    104676121 (AKT2)
   05223 Non-small cell lung cancer
    104676121 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104676121 (AKT2)
   05017 Spinocerebellar ataxia
    104676121 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104676121 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104676121 (AKT2)
   04931 Insulin resistance
    104676121 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104676121 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104676121 (AKT2)
   05135 Yersinia infection
    104676121 (AKT2)
   05152 Tuberculosis
    104676121 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104676121 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    104676121 (AKT2)
   05161 Hepatitis B
    104676121 (AKT2)
   05160 Hepatitis C
    104676121 (AKT2)
   05164 Influenza A
    104676121 (AKT2)
   05162 Measles
    104676121 (AKT2)
   05168 Herpes simplex virus 1 infection
    104676121 (AKT2)
   05163 Human cytomegalovirus infection
    104676121 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104676121 (AKT2)
   05169 Epstein-Barr virus infection
    104676121 (AKT2)
   05165 Human papillomavirus infection
    104676121 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104676121 (AKT2)
   05142 Chagas disease
    104676121 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104676121 (AKT2)
   01524 Platinum drug resistance
    104676121 (AKT2)
   01522 Endocrine resistance
    104676121 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104676121 (AKT2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104676121 (AKT2)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   104676121 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 104676121
NCBI-ProteinID: XP_010379170
UniProt: A0A2K6RHX8
LinkDB
Position
12
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRTPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVIQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccacggtacttccttctgaagagcgatggctccttcattgggtacaaggag
aggcctgaggcccctgatcagacccttccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagaggccacggcccaacacattcgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagacgagagggaggaatggatg
cgggccatccagatggtcgccaacagcctcaagcagcggaccccaggtgaggaccccatg
gactacaagtgtggctcccccagtgactcctccgcggccgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgattttgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgcaaacggtggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagattgtc
tcggctcttgagtacttgcactcacgggacgtggtgtaccgtgacatcaagctggaaaac
ctcatgctggataaagacggccacatcaagatcactgactttggcctctgcaaagaaggc
atcagtgacggggctaccatgaaaaccttctgtgggaccccagagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggttgggtgtggtcatg
tacgagatgatgtgcggccgcctgcctttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtgatccagaag
aagctcctgccgcccttcaaacctcaggtcacgtccgaggtcgacacaaggtactttgat
gatgaattcaccgcccagtccatcacaatcacaccccccgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115893905
Entry
115893905         CDS       T03989                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04910  Insulin signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04922  Glucagon signaling pathway
rro04923  Regulation of lipolysis in adipocytes
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04973  Carbohydrate digestion and absorption
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    115893905
   04012 ErbB signaling pathway
    115893905
   04014 Ras signaling pathway
    115893905
   04015 Rap1 signaling pathway
    115893905
   04370 VEGF signaling pathway
    115893905
   04371 Apelin signaling pathway
    115893905
   04630 JAK-STAT signaling pathway
    115893905
   04668 TNF signaling pathway
    115893905
   04066 HIF-1 signaling pathway
    115893905
   04068 FoxO signaling pathway
    115893905
   04072 Phospholipase D signaling pathway
    115893905
   04071 Sphingolipid signaling pathway
    115893905
   04024 cAMP signaling pathway
    115893905
   04022 cGMP-PKG signaling pathway
    115893905
   04151 PI3K-Akt signaling pathway
    115893905
   04152 AMPK signaling pathway
    115893905
   04150 mTOR signaling pathway
    115893905
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    115893905
  09143 Cell growth and death
   04210 Apoptosis
    115893905
   04218 Cellular senescence
    115893905
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    115893905
   04550 Signaling pathways regulating pluripotency of stem cells
    115893905
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    115893905
   04613 Neutrophil extracellular trap formation
    115893905
   04620 Toll-like receptor signaling pathway
    115893905
   04625 C-type lectin receptor signaling pathway
    115893905
   04660 T cell receptor signaling pathway
    115893905
   04662 B cell receptor signaling pathway
    115893905
   04664 Fc epsilon RI signaling pathway
    115893905
   04666 Fc gamma R-mediated phagocytosis
    115893905
   04062 Chemokine signaling pathway
    115893905
  09152 Endocrine system
   04910 Insulin signaling pathway
    115893905
   04922 Glucagon signaling pathway
    115893905
   04923 Regulation of lipolysis in adipocytes
    115893905
   04920 Adipocytokine signaling pathway
    115893905
   04929 GnRH secretion
    115893905
   04915 Estrogen signaling pathway
    115893905
   04914 Progesterone-mediated oocyte maturation
    115893905
   04917 Prolactin signaling pathway
    115893905
   04926 Relaxin signaling pathway
    115893905
   04935 Growth hormone synthesis, secretion and action
    115893905
   04919 Thyroid hormone signaling pathway
    115893905
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    115893905
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    115893905
  09156 Nervous system
   04725 Cholinergic synapse
    115893905
   04728 Dopaminergic synapse
    115893905
   04722 Neurotrophin signaling pathway
    115893905
  09158 Development and regeneration
   04380 Osteoclast differentiation
    115893905
  09149 Aging
   04211 Longevity regulating pathway
    115893905
   04213 Longevity regulating pathway - multiple species
    115893905
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115893905
   05205 Proteoglycans in cancer
    115893905
   05230 Central carbon metabolism in cancer
    115893905
   05231 Choline metabolism in cancer
    115893905
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    115893905
  09162 Cancer: specific types
   05210 Colorectal cancer
    115893905
   05212 Pancreatic cancer
    115893905
   05225 Hepatocellular carcinoma
    115893905
   05226 Gastric cancer
    115893905
   05214 Glioma
    115893905
   05221 Acute myeloid leukemia
    115893905
   05220 Chronic myeloid leukemia
    115893905
   05218 Melanoma
    115893905
   05211 Renal cell carcinoma
    115893905
   05215 Prostate cancer
    115893905
   05213 Endometrial cancer
    115893905
   05224 Breast cancer
    115893905
   05222 Small cell lung cancer
    115893905
   05223 Non-small cell lung cancer
    115893905
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    115893905
   05017 Spinocerebellar ataxia
    115893905
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    115893905
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    115893905
   04931 Insulin resistance
    115893905
   04933 AGE-RAGE signaling pathway in diabetic complications
    115893905
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115893905
   05135 Yersinia infection
    115893905
   05152 Tuberculosis
    115893905
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    115893905
   05170 Human immunodeficiency virus 1 infection
    115893905
   05161 Hepatitis B
    115893905
   05160 Hepatitis C
    115893905
   05164 Influenza A
    115893905
   05162 Measles
    115893905
   05168 Herpes simplex virus 1 infection
    115893905
   05163 Human cytomegalovirus infection
    115893905
   05167 Kaposi sarcoma-associated herpesvirus infection
    115893905
   05169 Epstein-Barr virus infection
    115893905
   05165 Human papillomavirus infection
    115893905
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115893905
   05142 Chagas disease
    115893905
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    115893905
   01524 Platinum drug resistance
    115893905
   01522 Endocrine resistance
    115893905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    115893905
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     115893905
Protein kinases [BR:rro01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   115893905
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 115893905
NCBI-ProteinID: XP_030775115
LinkDB
Position
16
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagacactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcggacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcagttttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system