KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654225
Entry
104654225         CDS       T03989                                 

Gene name
PDE1C
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04020  Calcium signaling pathway
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04924  Renin secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104654225 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104654225 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104654225 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    104654225 (PDE1C)
   04742 Taste transduction
    104654225 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104654225 (PDE1C)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     104654225 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 104654225
NCBI-ProteinID: XP_010351622
UniProt: A0A2K6RN88
LinkDB
Position
6
AA seq 768 aa
MTDASNRKEGFKKCRSATFSIDGYSFTIVANEAGDKNARPLARFSRSKSQNCLWNSLIDG
LTGNVKEKPRPTIVHDPRPPEEILADELPQLDSPEVLVKTSFRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SEEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSPTGGTGQRRSSLNSISSSDAKR
SGVKSSGSEGSAPINSSVIPIDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEARSEAEEGASGKSEKKTSGEAENQVSGTRMNKSDIPRGKNSKAEKSLEQ
QQNGDLKDGKNKTDKKDHSNIGNDSKKTDGIKRHSHSSPAPSTSSTSRLTLPVIKTPLRH
FKRPAYASSSYAPSVTKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgacggacgccagcaacaggaaggagggcttcaaaaaatgccggagcgccactttcagc
atcgatggctacagcttcaccatcgttgcaaatgaagctggagacaagaatgccagacca
ctggcccgcttctctcggtctaagtcacagaactgtctgtggaactccctcatcgacggg
ctcacagggaatgtcaaggagaagccacggccaacaattgtccatgaccctcgaccccca
gaagaaatcctagctgatgaattgccacagctggatagcccggaagtcttggtgaagaca
tccttcagattacggtctttggtcaaacaattagagagaggggaagcttcagtggtagat
cttaagaagaatttggaatatgcagccacagtgcttgaatctgtgtatattgatgaaaca
aggagactcctggatacagaggatgagctcagtgacattcagtcagatgctgtgccttct
gaggtccgagactggctggcctccaccttcacgcggcagatggggatgatgctcaggagg
agcgaggagaagccccggttcaagagcatcgttcacgcggtgcaggctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttggactgagctatccaccagctgttatt
gaggcattaaaggatgtggacaagtggtcctttgatgtcttttccctcaatgaggccagt
ggagatcatgcactgaaatttattttctatgaactactcacacgctatgatctgatcagc
cgtttcaagatccccatttctgcacttgtctcatttgtggaggccctggaagtgggatac
agcaagcacaaaaatccttaccataacttaatgcacgctgccgacgttacacagacagtg
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatctttgct
ataatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcagactcggtctgatccagctattctgtacaatgacagatctgtactggagaatcac
catttaagtgcagcttatcgccttctgcaagatgacgaggaaatgaatattctgattaac
ctctcaaaagatgactggagggagtttcgaaccttggtaattgaaatggtgatggccacg
gatatgtcttgtcacttccaacaaatcaaagcaatgaagactgctctgcagcagccagaa
gccattgaaaagccaaaagccttatcccttatgctgcatacggcagatattagccatcca
gcaaaagcgtgggacctccatcatcgctggacaatgtcactcctggaggagttcttcaga
cagggtgacagagaagcagaactggggctgcctttttctcctctgtgtgaccgaaagtcc
actatggttgctcagtcacaagtaggtttcattgatttcattgtggaacccaccttcact
gtgcttacggacatgaccgagaagattgtgagtccattaattgatgaaacctctccaact
ggtgggacaggacagagacgttcgagtttgaatagcatcagctcatcagatgccaagcga
tcaggtgtcaagagctctggttcggagggaagtgccccaatcaacagttctgtcattccc
attgactataagagctttaaagctacttggactgaggtggtgcacatcaatcgggagaga
tggagggccaaggtacccaaagaggagaaggccaagaaggaagcagaggaaaaggctcgc
ctggccgcagaggagcagcaaaaggaaatggaagccagaagcgaggctgaggaaggcgca
tctggcaaatctgagaaaaagacgtctggagaagctgagaatcaagtcagtggaacacgg
atgaacaaaagtgacatccctcgtgggaaaaattccaaagctgagaagtcgttagaacag
caacagaatggtgacttgaaagatggtaaaaataagacagacaagaaggatcactctaac
atcggaaatgattcaaagaaaacagatggcataaaacgacattctcacagctcaccagcc
ccaagcaccagctccacaagtcgccttacattgccagtcatcaagactcctttgcgtcat
tttaaacgcccagcttatgcatctagctcctatgcaccttcagtcacaaagaaaactgat
gagcatcctgcaagatataagatgctggatcagaggatcaaaatgaaaaagattcagaac
atctcacataactggaacagaaaatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666593
Entry
104666593         CDS       T03989                                 

Gene name
PDE1A
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A isoform X3
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04020  Calcium signaling pathway
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04924  Renin secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104666593 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104666593 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104666593 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    104666593 (PDE1A)
   04742 Taste transduction
    104666593 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104666593 (PDE1A)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     104666593 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 104666593
NCBI-ProteinID: XP_010366996
UniProt: A0A2K6PZM6
LinkDB
Position
14
AA seq 528 aa
MDDHVTIRKKHLQRPIFRLRCLVKQLERGDVNIVDLKKNIEYAASVLEAVYIDETRRLLD
TEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYR
KTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIP
VSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAA
AIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEMNILVNLSKDDW
RDLRNLVIEMVLSTDMSGHFQQIKNIRSNLQQPEGIDRAKTMSLILHAADISHPAKSWKL
HYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFSLLTDST
EKIVIPLIEEASKAETSSYVASGSTTIVGLHIADALRRPNAKGSMSDGSYSPDYSLAAVD
LKSFKNNLVDIIQQNKERWKELAAQGEPDLHKNSEDLVNAEEKHETHS
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggatgaccatgtcacaatcaggaagaaacatctccaaagacccatctttagactaaga
tgcttagtgaagcagctggaaagaggtgacgttaacatcgttgacttaaagaagaatatt
gaatatgcggcatctgtactggaagcagtttatatcgatgagacaagaagacttctggat
actgaagatgagctcagtgacattcagactgactcagtcccatctgaagtccgggactgg
ttggcttctacctttacacggaaaatggggatgacaaaaaagaaacctgaggaaaaacca
aaatttcggagcattgtgcatgctgttcaagctggaatttttgtggaaaggatgtaccga
aaaacatatcatatggttggtttggcatatccagcagctgtcatcgtaacattaaaggat
gttgataaatggtcttttgatgtatttgccctaaatgaagcaagtggagagcatagtctg
aagtttatgatttatgaattgtttaccagatatgatcttatcaaccgtttcaagattcct
gtttcttgcctaatcacctttgcagaagctttagaagttggttacagcaagtacaaaaat
ccatatcacaatttgattcatgcagctgatgtcactcaaactgtgcattatataatgctt
cacacaggtatcatgcactggctcactgaactggaaattttagcaatggtctttgctgcc
gccattcatgattacgagcatacagggacaacaaacaactttcacattcagacaaggtca
gatgttgccattttgtataatgatcgctctgtccttgagaatcaccatgtgagtgcagct
tatcgacttatgcaagaagaagaaatgaatatcttggtaaatttatccaaagatgactgg
agggaccttcggaacctagtgattgaaatggttttatctacagacatgtcaggtcacttc
cagcaaattaaaaatataagaagcaatttgcagcagcctgaagggattgacagagccaaa
accatgtccctgattctccatgcagcagacatcagccacccagccaaatcctggaagctg
cactatcggtggaccatggccctaatggaggagtttttcctgcagggagataaagaagct
gaattagggcttcccttttccccactttgtgatcggaagtcaaccatggtggcccagtca
caaataggtttcatcgatttcatagtagagccaacattttctcttctgacagactcaaca
gagaaaattgttattcctcttatagaggaagcctcaaaagccgaaacgtcttcctatgtg
gcaagcggctcaaccaccattgtggggttacacattgctgatgcactaagacgaccaaat
gcaaaaggttccatgagcgatgggtcctattccccagactactcccttgcagcagtggac
ctgaagagcttcaagaacaacctggtggacatcattcagcagaacaaagagaggtggaaa
gagttagctgcacaaggtgaacctgatctccataagaactcagaagacctagtaaatgct
gaagaaaaacatgagacacattcatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670555
Entry
104670555         CDS       T03989                                 

Gene name
PDE1B
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04020  Calcium signaling pathway
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04924  Renin secretion
rro05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104670555 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104670555 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104670555 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    104670555 (PDE1B)
   04742 Taste transduction
    104670555 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    104670555 (PDE1B)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     104670555 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N La_HTH_kDCL
Other DBs
NCBI-GeneID: 104670555
NCBI-ProteinID: XP_010372152
UniProt: A0A2K6R2I7
LinkDB
Position
10
AA seq 536 aa
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNL
EYTASLLEAVYIDETRHILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNRAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIEVLAIVFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSV
FRLMQDDELNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRPPSLDVEVGDPNPDVVS
FRSTWVKYIQENKQKWKERAASGITNQMSIDELSPCDEEAPPSPAEDEHNQNGNLD
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccagagatgctggaggagtcggattgcccgtcaccc
ctggagctgaagtcagctcccagcaagaagatgtggattaagcttcggtctctgctgcgc
tacatggtgaagcagttggagaacggggaggtaaacatcgaggagctgaagaaaaatctg
gagtacacagcttctctgctggaagccgtctacatagatgagacacggcatatcttggac
acggaggacgagctgcaggagctgcggtcagatgccgtgccttcggaggtgcgggactgg
ctggcctccaccttcacccagcaggcccgggccaaaggccgccgagcagaggagaagccc
aagttccgaagcattgtgcacgctgtgcaggctgggatcttcgtggaacggatgttccgg
agaacatacacctctgtgggccccacttattctactgcggtcctcaactgtctcaagaac
ctggatctctggtgctttgatgtcttttccttgaaccgggcagcagatgaccatgccctg
aggaccattgtttttgaattgctgactcggcataacctcatcagccgcttcaagattccc
actgtgtttttgatgagtttcctggaggccttggagacaggctatggaaagtacaagaat
ccttaccacaaccagatccatgcagccgatgttacccagacagtccattgcttcttgctc
cgcacagggatggtgcactgcctgtcggagattgaggtcctggccatcgtctttgctgca
gctatccatgattatgagcacacgggcactaccaacagcttccacatccagaccaagtca
gaatgtgccatcctgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtc
ttccgactgatgcaggatgatgagctgaacattttcatcaacctcaccaaggatgagttt
gtagaactccgagccctggtcattgagatggtgttggccacagacatgtcctgccatttc
cagcaagtgaagaccatgaagacagccttgcaacagctggagaggattgacaagcccaag
gccctgtcgctactgctccatgctgctgacatcagccacccaaccaagcagtggtcggtc
cacagccgctggaccaaggccctcatggaggaattcttccgccagggtgacaaggaggca
gagttgggcctgcccttttctcctctctgtgaccgcacttccacgctggtggcacagtct
cagatagggttcatcgacttcattgtggagcccacattctctgtgctgactgatgtggca
gagaagagtgttcagcccctggcggatgaggactccaagtctaaaaaccagcccagcttt
cagtggcgcccgccctctctggatgtggaagtgggagaccccaaccctgatgtggtcagc
tttcgttccacctgggtcaagtacattcaggagaacaaacagaaatggaaagaacgggca
gcaagtggcatcaccaaccagatgtccattgacgagttgtccccctgtgacgaagaggca
cccccatcccctgccgaagatgaacacaaccaaaatgggaatctggactag

DBGET integrated database retrieval system