KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654275
Entry
104654275         CDS       T03989                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05206  MicroRNAs in cancer
rro05212  Pancreatic cancer
rro05214  Glioma
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104654275 (CDKN2A)
   04115 p53 signaling pathway
    104654275 (CDKN2A)
   04218 Cellular senescence
    104654275 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654275 (CDKN2A)
   05206 MicroRNAs in cancer
    104654275 (CDKN2A)
   05203 Viral carcinogenesis
    104654275 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104654275 (CDKN2A)
   05225 Hepatocellular carcinoma
    104654275 (CDKN2A)
   05214 Glioma
    104654275 (CDKN2A)
   05220 Chronic myeloid leukemia
    104654275 (CDKN2A)
   05218 Melanoma
    104654275 (CDKN2A)
   05219 Bladder cancer
    104654275 (CDKN2A)
   05223 Non-small cell lung cancer
    104654275 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104654275 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104654275 (CDKN2A)
   05163 Human cytomegalovirus infection
    104654275 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104654275 (CDKN2A)
   01522 Endocrine resistance
    104654275 (CDKN2A)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank DUF2384
Other DBs
NCBI-GeneID: 104654275
NCBI-ProteinID: XP_010351690
UniProt: A0A2K6QDN9
LinkDB
Position
16
AA seq 148 aa
MEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSAHVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLAVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAR
YLRAAAGGTRGSSHARIDAAEGPSGIPD
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagccttcggcggactggctggccacggctgcggcccggggtcgggtagaggaggtg
cgggcgctgctcgaggcgggggcgctgcccaacgcaccgaatagttacggtcggaggccg
atccaggtcatgatgatgggcagcgcccacgtggcggagctgctgctgcttcacggcgca
gagcccaactgcgccgaccccgccactctcacccgacccgtgcacgacgctgcccgggag
ggcttcctggacacgctggcggtgctgcaccgggccggggcgcggctggacgtacgcgat
gcctggggccgtctgcccgtggacctggctgaggagcggggccatcgcgatgtcgcacgg
tacctgcgcgcggctgcggggggcaccagaggcagtagccatgcccgcatagatgccgcg
gaaggtccctcaggcatccccgattga

DBGET integrated database retrieval system