KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654362
Entry
104654362         CDS       T03989                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04066  HIF-1 signaling pathway
rro04072  Phospholipase D signaling pathway
rro04136  Autophagy - other
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04371  Apelin signaling pathway
rro04613  Neutrophil extracellular trap formation
rro04630  JAK-STAT signaling pathway
rro04659  Th17 cell differentiation
rro04714  Thermogenesis
rro04910  Insulin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04920  Adipocytokine signaling pathway
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05221  Acute myeloid leukemia
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104654362 (MTOR)
   04371 Apelin signaling pathway
    104654362 (MTOR)
   04630 JAK-STAT signaling pathway
    104654362 (MTOR)
   04066 HIF-1 signaling pathway
    104654362 (MTOR)
   04072 Phospholipase D signaling pathway
    104654362 (MTOR)
   04151 PI3K-Akt signaling pathway
    104654362 (MTOR)
   04152 AMPK signaling pathway
    104654362 (MTOR)
   04150 mTOR signaling pathway
    104654362 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104654362 (MTOR)
   04136 Autophagy - other
    104654362 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    104654362 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104654362 (MTOR)
   04659 Th17 cell differentiation
    104654362 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104654362 (MTOR)
   04920 Adipocytokine signaling pathway
    104654362 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    104654362 (MTOR)
   04919 Thyroid hormone signaling pathway
    104654362 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    104654362 (MTOR)
   04213 Longevity regulating pathway - multiple species
    104654362 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    104654362 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654362 (MTOR)
   05206 MicroRNAs in cancer
    104654362 (MTOR)
   05205 Proteoglycans in cancer
    104654362 (MTOR)
   05230 Central carbon metabolism in cancer
    104654362 (MTOR)
   05231 Choline metabolism in cancer
    104654362 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104654362 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104654362 (MTOR)
   05212 Pancreatic cancer
    104654362 (MTOR)
   05225 Hepatocellular carcinoma
    104654362 (MTOR)
   05226 Gastric cancer
    104654362 (MTOR)
   05214 Glioma
    104654362 (MTOR)
   05221 Acute myeloid leukemia
    104654362 (MTOR)
   05215 Prostate cancer
    104654362 (MTOR)
   05224 Breast cancer
    104654362 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104654362 (MTOR)
   05014 Amyotrophic lateral sclerosis
    104654362 (MTOR)
   05016 Huntington disease
    104654362 (MTOR)
   05017 Spinocerebellar ataxia
    104654362 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    104654362 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104654362 (MTOR)
   04931 Insulin resistance
    104654362 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104654362 (MTOR)
   05168 Herpes simplex virus 1 infection
    104654362 (MTOR)
   05163 Human cytomegalovirus infection
    104654362 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104654362 (MTOR)
   05165 Human papillomavirus infection
    104654362 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104654362 (MTOR)
   01522 Endocrine resistance
    104654362 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104654362 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104654362 (MTOR)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104654362 (MTOR)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   104654362 (MTOR)
Membrane trafficking [BR:rro04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    104654362 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 104654362
NCBI-ProteinID: XP_010351824
UniProt: A0A2K6Q8V6
LinkDB
Position
12
AA seq 2549 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNTTTAATTATTATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagt
gttctacagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccaacactatgtcaccatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccatcggccgccttgccatggcaggagacactttc
accgctgagtatgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtggccgcccttcgtgcctgtttgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaggggtttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatccttaatgagctggtccgaatcagcagcatggagggagag
cgtctgagggaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagcttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttggggcctcccccagcccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtatgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacgcagtacctccaagatactatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttgcctcgagtgctggacatcatccga
gcagccctgcctccaaaggacttcgcccataagaggcagaaggcaatgcaggtggacgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaagcatccagcaggat
atcaaggagctgctggagcccatgctggcagtaggactaagtcctgccctcactgcagtg
ctctacgacctgagccgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtccctggtccttatgcacaaaccgctccgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacaaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcattttctaaacagtgagcacaaggagatccgcatg
gaggctgcccgcacctgctcccgcctgctcacgccctccatccacctcatcagtggccat
gctcatgtggttagccagactgcagtgcaagtggtggcagatgtgcttagcaagctgctc
gtggttgggataacagatcctgaccctgacattcgctattgtgtcttggcatccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccctgcgtttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgcgccccgactcatccgtccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcattatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccctacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggttaacatgggaaac
ttgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaagtgtgtgcagtttctgccccaggtcatgcccacgttccttaatgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacgtcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgttgcgt
gtcttcatgcatgacaacagcccaggccgcatcgtctctatcaagttattggctgcaatc
cagctgtttggcgccaacctggatgactacctacatttactgctgcctcctattgtgaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgattatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcactt
gtttttcaactagggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaatcatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcgaatgcttaggagtggc
caaggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaatctccaaaaggcctggggtgctgcccggagggtctccaaagatgactgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccaatggccagggatctcttcaatgct
gcgtttgtgtcctgctggtctgaattgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgaaagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgccctg
gtggcctatgacaagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgccttgaggccctgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcatgaagacatgagaacctggctcaagtacgcgagcctgtgt
ggcaagagtggcagactggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcccctgccgacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagcgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaacgagagcacaatccccaaagtgctgcagtactacagcgctgccacc
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgacgagaagaagaaactgcgtcatgcc
agcggggctaacatcaccaacaccaccactgccgccaccacggccactactgccaccacc
actgccagcaccgagggcagcaacagtgagagtgaggccgagagcactgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acggtgcctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgttaat
gaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatactcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctaccccctgacagtggcttct
aagtctaccacgacagcccggcacaacgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctgtggcatgagatgtggcacgaaggcctggaagaggcctctcgtttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggagacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcactcaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatccaagcagaggccccggaaattgacacttatgggcagcaacgggcat
gagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatatgccgtcatccctttatcgaccaactcgggcctcattggctgggtg
ccccattgtgacacactgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccggactatgaccacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctacgggagcacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatcccgaacgagaacggattcctactctgccggccagtcagtcgaaattttggacggt
gtggaacttggggagccagcccataagaaaacggggaccacagtgccagaatcgattcat
tctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacacaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctatattggctggtgccctttctggtaa

DBGET integrated database retrieval system