KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654431
Entry
104654431         CDS       T03989                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04064  NF-kappa B signaling pathway
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104654431 (TRAF3)
   04668 TNF signaling pathway
    104654431 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104654431 (TRAF3)
   04621 NOD-like receptor signaling pathway
    104654431 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    104654431 (TRAF3)
   04657 IL-17 signaling pathway
    104654431 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654431 (TRAF3)
   05203 Viral carcinogenesis
    104654431 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104654431 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104654431 (TRAF3)
   05160 Hepatitis C
    104654431 (TRAF3)
   05171 Coronavirus disease - COVID-19
    104654431 (TRAF3)
   05164 Influenza A
    104654431 (TRAF3)
   05162 Measles
    104654431 (TRAF3)
   05168 Herpes simplex virus 1 infection
    104654431 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104654431 (TRAF3)
   05169 Epstein-Barr virus infection
    104654431 (TRAF3)
   05165 Human papillomavirus infection
    104654431 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin zf-C3HC4_2 MPS2 Tropomyosin_1 Spc7 Cast Spc29 zf-RING_4 KxDL T3SSipB FliJ Exonuc_VII_L BLOC1_2 DUF1664 Fib_alpha GAS SPATA24 DUF3450
Other DBs
NCBI-GeneID: 104654431
NCBI-ProteinID: XP_030786938
LinkDB
Position
5
AA seq 568 aa
MESSKKMDSPGPLQTNPPLKLHTDRSAGMPIFAPEQGGYKEKFVKTVEDKYKCEKCRLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGHLLVHLKNDCHFEELPCVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQALLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactcccctggcccgctgcagactaacccgccgctaaag
ctgcacactgaccgcagtgctgggatgccgatttttgcccccgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgtcgcctggtgctg
tgcagcccgaagcagactgaatgtgggcaccgcttctgcgagagctgcatggccgccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaacgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtacgtgctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccatgtggaaaaggcgtgtaaataccgtgaagccacgtgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacatgaggacaccgactgtccctgcgtg
gtggtatcctgccctcacaaatgcagcgtccaggctctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagctcgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctggcc
gacatggacctccgcttccaggtcctggagaccgccagctacaacggcgtgctcatctgg
aagattcgtgactacaagcggcggaagcaggaggctgtcatggggaagaccctgtccctt
tacagccagcctttctacactggctactttggctataagatgtgtgccagggtctacctg
aacggggacgggatgggaaaggggacgcacctgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccttggccatttaagcagaaagtgacactcatgctgatggat
caggggtcctctcggcggcatttgggagatgcgttcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatattgcctctggctgcccggtctttgtggcccag
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658364
Entry
104658364         CDS       T03989                                 

Gene name
TRAF6
Definition
(RefSeq) LOW QUALITY PROTEIN: TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04064  NF-kappa B signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro04140  Autophagy - animal
rro04144  Endocytosis
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04722  Neurotrophin signaling pathway
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104658364 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104658364 (TRAF6)
   04064 NF-kappa B signaling pathway
    104658364 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104658364 (TRAF6)
   04140 Autophagy - animal
    104658364 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104658364 (TRAF6)
   04621 NOD-like receptor signaling pathway
    104658364 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    104658364 (TRAF6)
   04657 IL-17 signaling pathway
    104658364 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104658364 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104658364 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104658364 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104658364 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104658364 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104658364 (TRAF6)
   05135 Yersinia infection
    104658364 (TRAF6)
   05133 Pertussis
    104658364 (TRAF6)
   05152 Tuberculosis
    104658364 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104658364 (TRAF6)
   05161 Hepatitis B
    104658364 (TRAF6)
   05160 Hepatitis C
    104658364 (TRAF6)
   05171 Coronavirus disease - COVID-19
    104658364 (TRAF6)
   05162 Measles
    104658364 (TRAF6)
   05168 Herpes simplex virus 1 infection
    104658364 (TRAF6)
   05169 Epstein-Barr virus infection
    104658364 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104658364 (TRAF6)
   05140 Leishmaniasis
    104658364 (TRAF6)
   05142 Chagas disease
    104658364 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104658364 (TRAF6)
   04121 Ubiquitin system [BR:rro04121]
    104658364 (TRAF6)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104658364 (TRAF6)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104658364 (TRAF6)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    104658364 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Spc29 zf-RING_11 U-box Tropomyosin_1 DUF16 PspA_IM30 EzrA AAA_13 ADIP FliJ UPF0242 DM DUF3450 TMF_DNA_bd CENP-F_leu_zip Filament Spc7 DUF1664 DivIC
Other DBs
NCBI-GeneID: 104658364
NCBI-ProteinID: XP_010356705
UniProt: A0A2K6RDB7
LinkDB
Position
15
AA seq 522 aa
MSLLNCENSCGSSQSESDCCVAMASSCSAATKDDSVSGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPHEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASVAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHXEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSGV
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgcaacaaaagatgatagtgtgagtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagaattt
gacccacccctagaaagcaagtacgaatgccccatctgcttgatggcactacgagaagca
gtgcaaacaccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcgaaacgtgagattctttctctgatggtgaagtgtccacatgaaggttgtttg
cataagatggaactgaggcatcttgaggatcatcaagcacattgtgagtttgctcttgtg
gattgtccgcagtgccaacgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcagtggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagctccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagagaaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agccttatacccgactctgggtatgtctcagaggtccggaatttccaggaaactatccac
cagttagagggtcgccttgtaagacaagaccatcagatccgggagctgactgctaaaatg
gaaactcagagtacgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaattgaagcacagcagtgcaatggaatttacatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctgggttc
tacacaggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacgatgcaaggagagtatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtccgaagca
cctgtaaggcaaaaccatngagagataatggatgccaaaccagacctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaactttcatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgcttcgacatgggtagccttcggagggagggttttcagccacgaagtactgattca
ggggtatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669131
Entry
104669131         CDS       T03989                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1 isoform X1
  KO
K03172  TNF receptor-associated factor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04064  NF-kappa B signaling pathway
rro04210  Apoptosis
rro04668  TNF signaling pathway
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104669131 (TRAF1)
   04668 TNF signaling pathway
    104669131 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104669131 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669131 (TRAF1)
   05202 Transcriptional misregulation in cancer
    104669131 (TRAF1)
   05203 Viral carcinogenesis
    104669131 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104669131 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd Not3
Other DBs
NCBI-GeneID: 104669131
NCBI-ProteinID: XP_010370324
UniProt: A0A2K6RRB3
LinkDB
Position
16
AA seq 416 aa
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCTGCLSENLRNGEDQICPKCRGE
DLQSVSPGSRLRTLERAHPEVAEAGVGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKTRMASGLESGPMALEQNLSDLQLQAAVEVARDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTGK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLNKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcatccagctcaggcagcagcccacgcccggcccctgatgagaatgagttccccttt
gggtgccctcccaccgtctgccaggacccaaaggagcctagggctctctgctgtacaggc
tgtctctctgagaacctgaggaacggcgaggatcagatctgccccaaatgcagaggggaa
gacctccagtctgtaagcccaggaagccgtcttcgaactctggagagggctcatcctgag
gtggccgaggctggagttgggtgcccctttgcaggtgtcggctgctccttcaagggaagc
ccacagtccgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgttg
gggttcatgaaacagtggaagacccgaatggcctctggcctggagtctgggcccatggct
ctagagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgagggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaagggaagctgcgtgtgtttgagaacatt
gttgctgtcctcaacaaggaggtggaggcctcccacctggccctggccacctccatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagctgcag
cagaccctagcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcaccttcctgtggaagatcaccaatgttaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactggcaag
tatggctacaagttatgcctgcggctgtacctgaatggagatggcactggaaagaggacc
cacctgtcgcttttcatcgtgatcatgagaggggagtatgatgcgttgctgccgtggcct
ttccggaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgat
gccttccggcctgacctaagctcggcgtccttccagaggccccagagtgaaaccaacgtg
gccagtggctgcccactcttcttccccctcaacaaactgcagtcacccaagcatgcctac
gtgaaggacgacacgatgttcctcaagtgcatcgtggagaccagcacttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669508
Entry
104669508         CDS       T03989                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04064  NF-kappa B signaling pathway
rro04217  Necroptosis
rro04621  NOD-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro05163  Human cytomegalovirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    104669508 (TRAF5)
   04668 TNF signaling pathway
    104669508 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104669508 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104669508 (TRAF5)
   04657 IL-17 signaling pathway
    104669508 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669508 (TRAF5)
   05203 Viral carcinogenesis
    104669508 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104669508 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104669508 (TRAF5)
   05168 Herpes simplex virus 1 infection
    104669508 (TRAF5)
   05163 Human cytomegalovirus infection
    104669508 (TRAF5)
   05169 Epstein-Barr virus infection
    104669508 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104669508 (TRAF5)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    104669508 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-TRAF_2 zf-RING_UBOX zf-RING_2 zf-RING_6 zf-ACC ATG16 Sina BORCS8 Mt_ATP_synt DUF4941 Spc29 Acetyltransf_11 Syntaxin-6_N PHM7_cyt DUF4279 MCPsignal
Other DBs
NCBI-GeneID: 104669508
NCBI-ProteinID: XP_030792382
LinkDB
Position
8
AA seq 557 aa
MAYSEEHRGMPCGFIRQNSGNSISLDFEPNIEYQFVERLEERYKCAFCRSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQAVQCSNENCREPVLRKDLKEHLSAYCQFREEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQE
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKSDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLNKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTGRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcttattcagaagagcatagaggtatgccctgtgggttcatccgtcagaattccggc
aactccatttccttggactttgagcccaatatagagtaccagtttgtggagcggttggaa
gagcgctacaaatgtgccttctgccgctcggtgcttcacaacccccaccagacaggatgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacacagtgccaatc
tgccctgtagacaaggaggtcatcaaatctcaggaggtttttaaagacaattgctgcaaa
agagaagtcctcaacttatatgtatattgcagcaatgctcctggatgtaacgccaaggtt
attctgggccggtaccaggatcaccttcagcagtgcttatttcaagctgtgcagtgttct
aatgagaactgccgggaaccagtcctacggaaagacctgaaagagcatttgagtgcatac
tgtcagtttcgagaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatcta
cagaatcatgaggaaaacttgtgtcctgaatacccagtattttgtcccaacaattgtgcg
aagattattctaaaaactgaggtggatgaacacctggctgtatgtcccgaagctgagcaa
gactgtccttttaagcactatggctgtgctgtaacggataaacggaggaacctgcaggaa
catgagcattcagccttacgggagcacatgcgtctggttttagaaaagaacgtccaatta
gaagaacagatttctgacttacacaagagcctagaacagaaagaaagtaaaatccagcag
ctagcagaaactataaagaaacttgaaaaggagttcaagcagtttgcacagttgtttggc
aaaaatggaagcttcctcccaaacatccaggtttttgccagtcacattgacaagtcagct
tggctagaagctcaagtgcatcaattattacaaatggttaaccagcaacaaaataaatct
gacctgaggcctttgatggaagcagttgatacagtgaaacagaaaattaccctgctagaa
aacaatgatcaaagattagctgttttagaagaggaaactaacaaacatgatacccacatt
aatattcataaagcacagctgaataaaaatgaagagcgatttaaactactggagggtact
tgctataatggaaagctcatttggaaggtgacagattacaagatgaagaagagggaggca
gtggatgggcacacagtgtccatcttcagccagtccttctacaccggccgctgtggctac
cggctgtgtgctagagcatacctgaatggggatgggtctgggaaggggacacacctgtcc
ctatactttgtggtcatgcgaggagagtttgactcactgttgcagtggccattcaggcag
agggtgacactgatgcttctggaccagagtggcaaaaaaaacattatggagaccttcaag
cctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcatctggc
tgtccccgctttgtggctcattctgttttggagaatgccaagaacgcctacattaaagat
gacactctgttcttgaaagtggctgtggacttaactgacctggaggatctctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669650
Entry
104669650         CDS       T03989                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04064  NF-kappa B signaling pathway
rro04071  Sphingolipid signaling pathway
rro04141  Protein processing in endoplasmic reticulum
rro04210  Apoptosis
rro04217  Necroptosis
rro04380  Osteoclast differentiation
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04668  TNF signaling pathway
rro04920  Adipocytokine signaling pathway
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05160  Hepatitis C
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104669650 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104669650 (TRAF2)
   04064 NF-kappa B signaling pathway
    104669650 (TRAF2)
   04668 TNF signaling pathway
    104669650 (TRAF2)
   04071 Sphingolipid signaling pathway
    104669650 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104669650 (TRAF2)
   04217 Necroptosis
    104669650 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104669650 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    104669650 (TRAF2)
   04657 IL-17 signaling pathway
    104669650 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104669650 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104669650 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669650 (TRAF2)
   05203 Viral carcinogenesis
    104669650 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104669650 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104669650 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    104669650 (TRAF2)
   05016 Huntington disease
    104669650 (TRAF2)
   05017 Spinocerebellar ataxia
    104669650 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    104669650 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104669650 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104669650 (TRAF2)
   05135 Yersinia infection
    104669650 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104669650 (TRAF2)
   05160 Hepatitis C
    104669650 (TRAF2)
   05168 Herpes simplex virus 1 infection
    104669650 (TRAF2)
   05163 Human cytomegalovirus infection
    104669650 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104669650 (TRAF2)
   05169 Epstein-Barr virus infection
    104669650 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104669650 (TRAF2)
   04121 Ubiquitin system [BR:rro04121]
    104669650 (TRAF2)
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104669650 (TRAF2)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     104669650 (TRAF2)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    104669650 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 MATH SlyX
Other DBs
NCBI-GeneID: 104669650
NCBI-ProteinID: XP_010370993
LinkDB
Position
16
AA seq 501 aa
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACGNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPIDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADGKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEAQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCENLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccttggagttgctacagcctggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcggaaacgtc
ctgcgcaggcccttccaggcgcagtgtggccaccggtactgctccttctgcctggccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggctttcccagataatgctgcccgcagggaggtg
gagagcctgccagccgtctgtcccattgatgggtgcacctggaaggggaccctgaaagaa
tatgagagctgccacgaaggccgctgcccgctcatgctgaccgaatgtcctgcatgcaaa
ggcctggtccgcctgggtgaaaaggagcgccacctggagcacgagtgcccagagagaagc
ctgagctgccggcattgccgggcgccctgctgcggggcagacgggaaggcgcaccacgag
gtctgccccaagttccccttgacttgtgatggctgcggcaagaaaaagatcccccgggag
aagtttcaggaccacgtcaagacttgtggcaagtgtcgggtcccttgtagattccacgcc
atcggctgcctcgagacggtggagggtgagaaacagcaagagcacgaggcacagtggctg
cgggagcacctggccatgctcctgagctcggtgctggaggcaaagcctctcttgggagac
cagagccatgcggggtcagagctcctacagaggtgcgagaacctggagaagaagacggcc
acttttgagaacattgtctgtgtcctgaaccgggaggtggagagggtggccatgactgcc
gaggcctgcagccggcagcaccggctggaccaagacaagattgaagccctgagtaacaag
gtgcagcagctggagaggagcattggcctcaaggatctggcgatggctgacctggagcag
aaggtcttggagatggaggcatccacctacgatggggtcttcatctggaagatctcagac
ttcgccaggaagcgccaggaagctgtggccggccgcacacccgccatcttctccccagcc
ttctacaccagcaggtacggctacaagatgtgtctgcgtatctacctgaacggcgacggc
accgggcgaggaacacacctgtccctcttctttgtggtgatgaagggcccgaatgacgcc
ctgctgcggtggcccttcaaccagaaggtgaccttaatgctgctcgaccagaataatcgg
gagcacgtgattgatgccttcaggcccgacgtgacctcgtcctcttttcagaggccagtc
aatgacatgaacatcgcaagcggctgccccctcttctgccctgtctccaagatggaggcc
aagaattcctacgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674107
Entry
104674107         CDS       T03989                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04657  IL-17 signaling pathway
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    104674107 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674107 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104674107 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-RING_5 zf-RING_2 zf-RING_6 zf-TRAF_2 zf-C3HC4_3 MATH zf-rbx1 Sina
Other DBs
NCBI-GeneID: 104674107
NCBI-ProteinID: XP_030779285
LinkDB
Position
19
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPMK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPGHLK
DSCSTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNFECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcctggtttcgactacaagttcctggagaagcccaagcgacggctgctgtgcccactg
tgcgggaagcccatgcgcgagcctgtgcaggtttccacctgcggccaccgtttctgcgac
acctgcctgcaggagttcctcagtgaaggcgtcttcaagtgccctgaggaccagcttcct
ctggactatgccaagatctacccagacccggagctggaagtacaagtattgggcctgcct
atccgctgcatccacagtgaggagggctgccgctggagtgggccactacgccatctacag
ggccacctgaatacctgcagcttcaacgtcgttccctgccctaatcgctgccccatgaaa
ctgagccgccgtgatctacctgcgcacttgcagcacgactgccccaagcggcgcctcaag
tgcgagttttgtggctgtgacttcagtggggaggcctatgagagccatgagggtatgtgc
ccccaggagagtgtctactgtgagaataaatgtggtgcccgcatgatgcggcggctgctg
gcccagcatgccacctctgagtgccccaagcgcactcagccctgcacctactgcaccaag
gagttcgtctttgacaccatccagagccaccagtaccagtgcccaaggctgcctgttccc
tgccccaaccagtgtggtgtgggcactgtggcccgggaggacctgccaggccatctgaag
gacagctgtagcactgccctggtgctctgcccattcaaagactccggctgcaagcacagg
tgccctaagctggcaatggcacggcatgtggaggagagtgtgaagccacatctggccatg
atgtgtgccctggtaagccggcaacggcaggagctgcaggagcttcggcgagagctggag
gagctatcagtgggcagtgatggtgtgctcatctggaagattggcagctatggacggcgg
ctacaggaggccaaggccaagcccaactttgagtgcttcagccctgccttctacacacat
aagtatggttacaagctacaggtgtctgcattcctcaatggcaatggcagtggcgagggc
acacacctctcactgtacattcgtgtgctgcctggtgcctttgacaatctccttgagtgg
ccctttgcccgccgtgtcaccttctccctgctggatcagagcgaccctgggctggctaaa
ccacagcacgtcactgagaccttccaccctgacccaaactggaagaatttccagaagccg
ggcacatggcggggctccctggatgagagttctctgggctttggttatcccaagttcatc
tctcaccaggacattcgaaagcgaaactatgtgcgggatgatgcagtcttcatccgtgct
gctgttgaactgccccggaagatccttagctga

DBGET integrated database retrieval system