KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654438
Entry
104654438         CDS       T03989                                 

Gene name
HSP90AA1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04612  Antigen processing and presentation
rro04621  NOD-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04659  Th17 cell differentiation
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro05132  Salmonella infection
rro05200  Pathways in cancer
rro05215  Prostate cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104654438 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104654438 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104654438 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104654438 (HSP90AA1)
   04612 Antigen processing and presentation
    104654438 (HSP90AA1)
   04659 Th17 cell differentiation
    104654438 (HSP90AA1)
   04657 IL-17 signaling pathway
    104654438 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104654438 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    104654438 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654438 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104654438 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104654438 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104654438 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104654438 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104654438 (HSP90AA1)
   04131 Membrane trafficking [BR:rro04131]
    104654438 (HSP90AA1)
   03051 Proteasome [BR:rro03051]
    104654438 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104654438 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104654438 (HSP90AA1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104654438 (HSP90AA1)
Chaperones and folding catalysts [BR:rro03110]
 Heat shock proteins
  HSP90
   104654438 (HSP90AA1)
Membrane trafficking [BR:rro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104654438 (HSP90AA1)
Proteasome [BR:rro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104654438 (HSP90AA1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    104654438 (HSP90AA1)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104654438 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 104654438
NCBI-ProteinID: XP_030786019
LinkDB
Position
5
AA seq 733 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaggaccaaccgatggaggaggaggaggttgagacgttc
gcctttcaggcagaaattgctcagttgatgtcactgattatcaatactttctattcgaac
aaagagatcttcctgagagagctaatttcaaattcatcagatgcattggacaaaatccgg
tatgagagcttgacggatcccagtaaattagactctgggaaagagctgcatattaacctg
ataccaaataaacaagatcgaaccctcactatcgtggatactggaattgggatgacgaag
gctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaagctggtgcagatatctccatgattggccagttcggtgttggtttttattct
gcttatttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgagcagtac
gcctgggagtcctcggcagggggatcatttacagtgaggaccgacacaggtgaacctatg
ggtcgtggaacaaaggtgatcctgcacctgaaagaagaccaaactgagtacttggaggaa
cgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccattactctt
tttgtggagaaggaacgtgataaagaagtcagcgatgatgaggctgaagaaaaagaagac
aaagaagaagaaaaagaaaaagaagagaaagagtccgaagacaaacctgaaattgaagat
gttggttctgatgaggaggaagaagaaaagaaggatggtgacaagaagaagaaaaagaag
attaaggagaagtacatcgatcaagaagaactcaacaaaacaaagcccatctggaccaga
aatcccgacgatattactaatgaggagtacggagaattctacaagagcttgaccaatgac
tgggaagatcacttggcagtgaagcatttttcagttgaaggacagttggaattcagagcc
cttctatttgtcccacgacgtgctccttttgacctatttgaaaacagaaagaaaaagaac
aacatcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatccct
gaatatctgaacttcattagaggggtggtagactcggaggatctccctctaaatatatcc
cgtgagatgttgcagcaaagcaaaattttgaaagttatcaggaagaatttggtcaaaaaa
tgcctagaactctttactgaactggcggaagataaagagaactacaagaagttctatgag
cagttctctaaaaacataaagcttggaatacatgaagactcacaaaatcggaagaagctt
tcagagctgttaaggtactacacatctgcctctggcgatgagatggtttctctcaaggat
tactgcaccagaatgaaggaaaaccagaaacatatctattatatcacaggtgagaccaag
gaccaggtagctaactcagcctttgtggaacgtcttcggaaacatggcttagaagtgatc
tatatgatcgagcccattgatgagtactgtgtccaacagctaaaggaatttgaggggaag
acattagtgtcagtcaccaaagagggcttggaacttccagaggatgaagaagaaaaaaag
aaacaggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacatactg
gagaaaaaagttgaaaaggtggttgtgtcaaaccgattggtgacgtctccatgctgtatt
gtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagcccta
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgac
cattccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtctgtg
aaggatctggtcatcttgctttacgaaactgcactcctgtcttctggcttcagtctggaa
gatccccagacacatgccaacaggatctacaggatgatcaaacttggtctgggtattgat
gaagatgatcctactgctgatgataccagtgcagctgtaactgaagaaatgccgcccctc
gaaggagatgacgacacatcacgcatggaagaagtagactaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104657467
Entry
104657467         CDS       T03989                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04657  IL-17 signaling pathway
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro05132  Salmonella infection
rro05200  Pathways in cancer
rro05215  Prostate cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104657467 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104657467 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    104657467 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104657467 (HSP90B1)
   04918 Thyroid hormone synthesis
    104657467 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104657467 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104657467 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104657467 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104657467 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104657467 (HSP90B1)
Chaperones and folding catalysts [BR:rro03110]
 Heat shock proteins
  HSP90
   104657467 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 MH1 DUF4518
Other DBs
NCBI-GeneID: 104657467
NCBI-ProteinID: XP_010355583
UniProt: A0A2K6R466
LinkDB
Position
10
AA seq 804 aa
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEDEPEEEPEETTEDTTEDTEQDEDE
EMDVGTDEEEQETAKESTAEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcggtcaga
gctgacgatgaagttgatgtggatggtacagtagaagaggatctgggtaaaagtagagaa
ggctcaaggacggatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcacaaataagagaacttagagagaagtcggaaaagtttgcctttcaagct
gaagttaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctaagagaactgatttcaaatgcttccgacgctttagataagataaggctaatatcactg
actgatgaaaatgccctttctggaaatgaggaactaacagttaaaattaagtgtgataag
gagaagaacctgctgcatgtcacagacaccggtgtaggaatgaccagagaagagttggtt
aagaaccttggtaccatagccaaatctggaacaagcgagtttttaaacaagatgactgaa
gcacaggaagatggccagtcaacttctgaattgattggccagtttggtgtcggtttctat
tccgccttccttgtagcagataaggttattgtcacatcaaaacacaacaatgatacccag
cacatctgggagtccgactccaatgaattttcggtaattgctgacccaagaggaaacact
ctaggacggggaacgacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaagtattcacagttcataaactttcctatttat
gtatggagtagcaagactgaaactgttgaggagccaatggaggaagaagaagcagccaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaagaagaagaagaaaagaaa
ccaaaaactaaaaaagttgaaaaaactgtctgggactgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatattcactttaccgctgaaggggaa
gttaccttcaaatcaattttatttgtacccacatctgctccacgtggtctatttgacgaa
tatggatctaaaaagagtgattacattaagctctatgtgcgccgtgtattcatcacagac
gacttccatgatatgatgcctaagtaccttaattttgtcaagggtgtggtggactcagat
gatctgcccttgaatgtttcccgcgagactcttcagcaacataaactgcttaaggtaatt
aggaagaagcttgttcgtaaaacgctggacatgatcaagaagattgctgatgataaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcgaatcgaacacgtcttgctaaacttcttaggttccagtcttctcatcatccaactgac
attactagcctagaccagtatgtagaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagttatttacctcacagaacctgtggatgaatactgcattcaggccctt
cctgaatttgatgggaagaggttccagaatgttgccaaggagggagtgaagtttgatgaa
agtgaaaaaactaaggagagtcgtgaagcagttgagaaagagtttgagcctctgctgaac
tggatgaaagataaagcccttaaggacaagattgaaaaggctgtggtatcccagcgcctg
acagaatctccatgtgctttggtggccagccagtatggatggtctggcaacatggagaga
atcatgaaagcacaagcataccaaacaggcaaggacatctctacaaattactatgcgagt
cagaagaaaacatttgaaattaatcccagacacccgctgatcagagatatgcttcgacga
attaaggaagatgaagatgataaaacagttttggatcttgctgtggttttgtttgaaaca
gcaacacttcggtcaggatatcttttaccagacactaaagcatatggagatagaatagaa
agaatgcttcgtctcagtttgaacattgaccctgatgcaaaggtggaagacgagcccgaa
gaagaacctgaagagacaacagaagacacaacagaagacacagagcaagacgaagacgaa
gaaatggatgtgggaacagatgaagaagaacaagaaacagcaaaggaatctacagctgaa
aaagatgaattgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667373
Entry
104667373         CDS       T03989                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04612  Antigen processing and presentation
rro04621  NOD-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04659  Th17 cell differentiation
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro05132  Salmonella infection
rro05200  Pathways in cancer
rro05215  Prostate cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104667373 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104667373 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104667373 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104667373 (HSP90AB1)
   04612 Antigen processing and presentation
    104667373 (HSP90AB1)
   04659 Th17 cell differentiation
    104667373 (HSP90AB1)
   04657 IL-17 signaling pathway
    104667373 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104667373 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    104667373 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667373 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104667373 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667373 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104667373 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104667373 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104667373 (HSP90AB1)
   04131 Membrane trafficking [BR:rro04131]
    104667373 (HSP90AB1)
   03051 Proteasome [BR:rro03051]
    104667373 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104667373 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104667373 (HSP90AB1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104667373 (HSP90AB1)
Chaperones and folding catalysts [BR:rro03110]
 Heat shock proteins
  HSP90
   104667373 (HSP90AB1)
Membrane trafficking [BR:rro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104667373 (HSP90AB1)
Proteasome [BR:rro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104667373 (HSP90AB1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    104667373 (HSP90AB1)
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104667373 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 104667373
NCBI-ProteinID: XP_010368073
UniProt: A0A2K6RR95
LinkDB
Position
4
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtctctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcctaaca
gacccttcgaagttggacagtggtaaagagctgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattggcatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcattcatggaggctcttcaggctggt
gcagacatctccatgattggacagtttggtgttggcttttattctgcctacctggtggca
gagaaggtggttgtgatcacaaagcacaacgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgggctgaccatggtgagcccattggcagaggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacttagaagagaggcgcgtcaaagaa
gtagtgaagaagcactctcagttcataggctatcccatcaccctttatttggagaaggag
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaagcccaagatcgaagatgtgggttcagatgaggaggatgac
agtggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gagctaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctacaagagcctcaccaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaattcagggcattgctattcattcctcgtcgggctccc
tttgacctttttgaaaacaagaagaaaaagaacaacatcaaactctatgtccgtcgtgtg
ttcatcatggacagctgtgatgagttaataccagagtatctcaattttattcgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgtaaaaacattgttaagaagtgtcttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccacgaggactccactaatcgccgccgcctgtctgagctgctgcgctatcacacctcc
cagtctggagatgagatgacatctttgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgacgagtac
tgtgtgcagcagctcaaggagtttgatgggaagagcctggtctcagttaccaaggagggt
ctggagctgcctgaggatgaggaggagaagaaaaagatggaagagagcaaggcaaagttt
gagaacctttgcaagctcatgaaagaaatcttagataagaaggttgagaaggtgacaatc
tccaataggcttgtgtcttcaccctgctgcattgtgaccagcacctatggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccactatgggctatatg
atggccaaaaagcacctggagatcaaccccgaccaccccattgtggagactctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctctcttcaggcttttcccttgaggatccccagacccactccaaccgcatc
taccgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaggaaccc
agtgctgcagttcctgatgagatcccccctcttgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667809
Entry
104667809         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04657  IL-17 signaling pathway
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro05132  Salmonella infection
rro05200  Pathways in cancer
rro05215  Prostate cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104667809
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104667809
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    104667809
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104667809
   04918 Thyroid hormone synthesis
    104667809
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667809
  09162 Cancer: specific types
   05215 Prostate cancer
    104667809
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667809
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104667809
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104667809
Chaperones and folding catalysts [BR:rro03110]
 Heat shock proteins
  HSP90
   104667809
SSDB
Motif
Pfam: HSP90 Ribosomal_L39 Peptidase_C92 FYVE_2
Other DBs
NCBI-GeneID: 104667809
NCBI-ProteinID: XP_030790762
LinkDB
Position
8
AA seq 586 aa
MSSHKTFRIKQFLVSKQKQNRPIPQWIRMKTGNKIRGPSGHYGRYAGAKYHYPQAETVDE
PMEEEELAKEDKEESDDEAAVEEEKEEKRPKIXKVEKTVWDWELITDITPIWQRPSKEVK
EDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSVLFVHTSAPRGLFDEYGSKKSDYIKL
YVRRVFITDDFHDMMSKYLNFVKGVVDSDDLPLNVSLETLXQHKLLKVTRKKLVCKTLDM
IKKIADDKYNDTFWKEFGTNIKLGVTEDHSNQTCLAKLLMFQSSHHPTDITTLDQYVERM
KRKQDKIYFMAGSSRKEAESSLFVXRLLKRGYEVLYLTEPVDEYCSQTLPKFDGKRFQNI
VKEGVKIHESEKTKKSCEAVEKEFEPLLNWMKDKALKDKTEKAVVSQHLTESPCALVASQ
YRLSGNMNRIMKAQAYQMSKDSSTNYYGSQKKTFEINPRHPLIRDMLXXIKEGEDDKTVL
DLAVVLCETAMLQAGYLLPDTKTYGDRIERMLXLSLNIDPDAKLEEEPNEEPEDTTEDTE
QDEDKEIDVGTDEEEQKTAKESTAEKDELYIILSLFVSFVERECEI
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgtcttctcacaagactttcaggattaagcagttcctggtcagcaaacaaaagcaaaat
cgtcctattccccagtggattcggatgaaaactggtaataaaatcaggggccccagtgga
cattatggacgttatgcaggagccaagtaccattaccctcaggctgaaactgttgatgag
cccatggaggaagaagaattagcaaaagaagacaaagaagaatctgatgatgaagctgca
gtagaggaagaaaaagaagaaaagagaccaaagatttaaaaagttgaaaaaactgtctgg
gactgggaacttattactgatatcacaccaatatggcagagaccatcaaaagaagtaaaa
gaagatgaatacaaagctttttacaaatcgttttcaaaggaaagtgatgaccccatggct
tatattcactttactgctgaaggggaagttaccttcaaatcagttttatttgtacacaca
tctgctccacgtggtctatttgacgaatatggatctaaaaagagtgattacattaagctc
tatgtgcgccgtgtattcatcacagatgacttccatgatatgatgtctaagtaccttaat
tttgtcaagggtgtggtggactcagatgatctccccttgaatgtttctcttgagactctt
tagcaacataaactgcttaaggtgactagaaagaagcttgtttgtaaaactctggacatg
atcaagaagattgctgatgataaatacaatgatactttttggaaagaatttggtaccaac
atcaagcttggtgtgactgaagaccactcaaatcaaacatgtcttgctaaacttcttatg
ttccagtcttctcatcatccaactgacattactaccctagaccagtatgtggaaagaatg
aagagaaaacaagacaaaatctacttcatggctgggtccagcagaaaagaggctgaatct
tctctatttgtttagcgacttctgaaaaggggctatgaagttctttacctcacagaacct
gtggatgaatactgcagtcagacccttcccaaatttgatgggaagaggttccagaatatt
gtcaaggaaggagtgaagattcatgaaagtgagaaaactaagaagagttgtgaagcagtt
gagaaagaatttgagcctctgctcaattggatgaaagataaagcccttaaggacaaaact
gagaaggctgtggtgtctcagcacctgacagaatctccgtgtgctttggtggccagtcag
taccgactgtctggcaacatgaacagaatcatgaaagcacaagcatatcaaatgagcaag
gacagctctacaaattactatgggagtcagaagaaaacatttgaaattaatcctagacac
ccgctgatcagagacatgctttgatgaattaaggaaggtgaagatgataaaacagtcttg
gatcttgctgtggttttgtgtgaaacagcaatgcttcaggcaggatatcttttaccagac
actaaaacatatggagatagaatagaaagaatgcttnccctaagtttgaacattgaccct
gatgcaaagttggaagaagaacccaacgaagaacctgaagacacaacagaagacacagag
caagatgaagacaaagaaatagatgtaggaacagatgaagaagaacaaaaaacagcaaag
gaatctacagctgaaaaagatgaattgtatattatactctcactgtttgtatcctttgtg
gagagggaatgtgaaatttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682584
Entry
104682584         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock protein HSP 90-alpha-like
  KO
K04079  molecular chaperone HtpG
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04217  Necroptosis
rro04612  Antigen processing and presentation
rro04621  NOD-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04659  Th17 cell differentiation
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro05132  Salmonella infection
rro05200  Pathways in cancer
rro05215  Prostate cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104682584
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104682584
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104682584
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104682584
   04612 Antigen processing and presentation
    104682584
   04659 Th17 cell differentiation
    104682584
   04657 IL-17 signaling pathway
    104682584
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104682584
   04914 Progesterone-mediated oocyte maturation
    104682584
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682584
  09162 Cancer: specific types
   05215 Prostate cancer
    104682584
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104682584
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104682584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104682584
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104682584
   04131 Membrane trafficking [BR:rro04131]
    104682584
   03051 Proteasome [BR:rro03051]
    104682584
   03029 Mitochondrial biogenesis [BR:rro03029]
    104682584
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104682584
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104682584
Chaperones and folding catalysts [BR:rro03110]
 Heat shock proteins
  HSP90
   104682584
Membrane trafficking [BR:rro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104682584
Proteasome [BR:rro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104682584
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    104682584
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104682584
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12 Zip
Other DBs
NCBI-GeneID: 104682584
NCBI-ProteinID: XP_030785916
LinkDB
Position
5
AA seq 733 aa
MPEETQTQDXPMEEEEVETFAFQAEITQLMSLIINTFYSNKEIFLRELISNSSDALDKIQ
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSACLVAEKVTVITKHNDDEQYAWESSGGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPQCAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELVEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMRENQKHIYYITGETKDQVTNSAFVERLRKQGLEVIYMIDPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIVKDILEKKVEKMVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDKSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETTLLSSGCSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPL
EGDDDTSRMEEAH
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaggacncaccgatggaggaggaggaggttgagacgttc
gcctttcaggcagaaatcacccagttgatgtcattgattatcaatactttctattcgaac
aaagagatctttctgagagagctaatttcaaattcatcagatgcattggacaaaatccag
tatgagagcttgacggatcccagtaaattagactctggaaaagagctgcatattaatctg
ataccaaataaacaagatagaaccctcactatcgtggatactggaattgggatgaccaag
gctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggctggtgcagatatctccatgattggccagttcggtgttggtttttattct
gcttgtttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgagcagtat
gcctgggagtcctcaggagggggatcatttacagtgaggacagacacaggtgaacctatg
ggtcgtggaacaaaggttatcctacacctgaaagaagaccaaactgagtacttggaggaa
cgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccattactctt
tttgtggagaaggaacgtgataaagaagtcagcgatgatgaggctgaagaaaaagaagac
aaagaagaagaaaaagaaaaagaagagaaagagtccgaagacaaacctgaaattgaagat
gttggttctgatgaggaagaagaagaaaagaaggatggtgacaagaagaagaaaaagaag
attaaggagaagtacatcgatcaagaagaactcaacaaaacaaagcccatctggaccaga
aatcccgacgatattactaatgaggagtacggagaattctacaagagcttgaccaatgac
tgggaagatcacttggcagtgaagcatttttcagttgaaggacagttggaattcagagcc
cttctatttgtcccacaatgtgctccttttgacctgtttgaaaacagaaagaaaaagaac
aacatcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatccct
gaatatctgaacttcattagaggggtggtagactcggaggatctccctctaaatatatcc
cgtgagatgttgcagcaaagcaaaattttgaaagttatcaggaagaatttggtcaaaaaa
tgcttagaactctttactgaactggtggaagataaagagaactacaagaagttctatgag
cagttctctaaaaacataaagcttggaatacatgaagactcacaaaatcggaagaagctt
tcagagctgttaaggtactacacatctgcctctggcgatgagatggtttctctcaaggat
tactgcaccagaatgagggaaaaccagaaacatatctattatatcacaggggagaccaag
gaccaggtaactaactcagcctttgtggaacgtcttcggaaacaaggcttagaagtgatc
tatatgatcgaccccatagatgagtactgtgtccaacagctaaaggaatttgaggggaag
acattagtgtcagtcaccaaagagggcttggaacttccagaggatgaagaagaaaaaaag
aaacaggaagagaaaaaaacaaagtttgagaacctctgcaaaatcgtgaaagacatactg
gagaaaaaagttgaaaagatggttgtgtcaaaccgattggtgacgtctccatgctgtatt
gtcacaagcacatacggctggaccgcaaacatggagagaatcatgaaagctcaagcccta
agagacaagtcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgac
cattccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtctgtg
aaggatctggtcatcttgctttacgaaactacactcctgtcttctggctgcagtctggaa
gatccccagacacatgccaacaggatctacaggatgatcaaacttggtctgggtattgat
gaagatgatcctactgctgatgataccagtgcagctgtaactgaggaaatgccgcccctc
gaaggagatgacgacacatcacgcatggaggaagcccactaa

DBGET integrated database retrieval system