KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654581Help
Entry
104654581         CDS       T03989                                 

Gene name
HSD17B4
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 4
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00120  Primary bile acid biosynthesis
rro01040  Biosynthesis of unsaturated fatty acids
rro01100  Metabolic pathways
rro01212  Fatty acid metabolism
rro04146  Peroxisome
Module
rro_M00861  beta-Oxidation, peroxisome, VLCFA
rro_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    104654581 (HSD17B4)
   01040 Biosynthesis of unsaturated fatty acids
    104654581 (HSD17B4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104654581 (HSD17B4)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     104654581 (HSD17B4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     104654581 (HSD17B4)
    4.2.1.119  enoyl-CoA hydratase 2
     104654581 (HSD17B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short MaoC_dehydratas adh_short_C2 SCP2 KR MaoC_dehydrat_N Alkyl_sulf_C AbrB-like
Motif
Other DBs
NCBI-GeneID: 104654581
NCBI-ProteinID: XP_010352093
UniProt: A0A2K6NTF4
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGRGSLAADKVVE
EIRRRGGKAVASYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIH
RVHLRGSFQVTRAAWDHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAI
EGRKSNIHCNTIAPNAGSRMTQTVLPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVG
AGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLS
KIDSEGVSANHTSHATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKDL
KFVYEGSSDFSCLPTFGVIIGQKSLMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRAG
KLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVA
VAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSA
RRILQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNA
YVDLAPTSDTSAKTPSEGGKLQSTLVFEEIGRRLKDVGPEVVKKVNAVFEWHITKGGNIG
AKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIM
LSQKLQMILKDYAKL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaccgctgagattcgacgggcgggtagtacttgtcaccggcgcaggggcagga
ttgggccgagcctatgccctggcttttgcagaaagaggagcgttagttgttgtgaatgat
ttgggaggggacttcaaaggagttggtagaggctccttagctgctgataaggttgttgaa
gaaataagaaggagaggtggaaaagcagtggccagctatgattcagtggaagaaggagag
aaggttgtgaagacagcactggatgcttttggaagaatagatgttgtggtcaacaatgct
ggaattctgagggatcgttcctttgctaggataagtgatgaagactgggatataatccac
agagttcatttgcggggctcattccaagtgacacgggcagcatgggatcacatgaagaaa
cagaaatatggaagaattattatgacttcatcagcttcaggaatatatggcaactttggc
caggcaaattatagtgctgcaaagttgggtcttctgggccttgcaaattctcttgcaatt
gaaggcagaaaaagcaacattcattgtaacaccattgctcctaatgctggatcacggatg
actcagacagttttgcctgaagatctcgtggaagctctgaagccagagtatgtggcacca
cttgtcctttggctttgtcacgagagttgtgaggagaatggtggcttgtttgaggttgga
gcaggatggattggaaaattacgctgggagaggactcttggagctattgtaagacaaaag
aatcacccaatgactcctgaggcggtgaaggctaactggaagaagatctgtgactttgag
aatgccagcaagcctcagagtatccaagaatcaactggcagtataattgaagttctaagt
aaaatagattcagaaggagtttcagcaaatcatactagtcatgcaacgtctacagcaaca
tcaggatttgctggagctattggccagaaactccctccattttcttatgcttatacggaa
ctggaagctattatgtatgcccttggagtgggagcatcaatcaaggatccaaaagatttg
aaatttgtttatgaaggaagttctgatttctcctgtttgcccacctttggagttatcata
ggtcagaagtctctaatgggtggaggattagcagaaattcctgggctttcaatcaacttt
gcaaaggttcttcatggagagcaatacttagagttatataaaccacttcccagagcagga
aaattaaaatgtgaagcagttgttgctgatgtcctagataaaggatccggtgtagtgatt
attatggatgtctattcttattctgagaaggaacttatatgccacaatcagttctctctc
tttcttgttggctctggaggctttggtggaaaacggacatcagacaaagtcaaggtagct
gtagccatacctaatagacctcctgatgctgtacttacggataccacttctcttaatcag
gctgctttgtaccgcctcagtggagactggaatcccttacacattgatcctaactttgct
agtctagcaggttttgacaagcccatattacatggattatgtacatttggattttctgcc
aggcgtattttacagcagtttgcagataatgatgtgtcaagattcaaggcaattaaggct
cgttttgcaaaaccagtatatccaggacaaactctacaaactgagatgtggaaggaagga
aacagaattcattttcaaaccaaggtccaagaaactggagacattgtcatttcaaatgca
tatgtggatcttgcaccaacatctgatacttcagctaagacaccctctgagggtgggaag
cttcagagtacgctcgtatttgaggaaataggacgccgcctaaaggatgttgggcctgag
gtggtgaagaaagtaaatgctgtatttgagtggcatataaccaaaggcggaaatattggg
gctaagtggactattgacctgaagagtggttctggaaaagtgtaccaaggccctgcaaaa
ggtgctgctgatacaacaatcatactttcagatgaagatttcatggaggtggtcctgggc
aagcttgaccctcagaaggcattctttagtggcaggctgaaggccagagggaacatcatg
ctgagccagaaactccagatgattcttaaagactatgccaagctctga

DBGET integrated database retrieval system