KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654717
Entry
104654717         CDS       T03989                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04611  Platelet activation
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104654717 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    104654717 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104654717 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104654717 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104654717 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104654717 (ITGA2B)
   04611 Platelet activation
    104654717 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654717 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104654717 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104654717 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    104654717 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104654717 (ITGA2B)
   05414 Dilated cardiomyopathy
    104654717 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104654717 (ITGA2B)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104654717 (ITGA2B)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104654717 (ITGA2B)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104654717 (ITGA2B)
CD molecules [BR:rro04090]
 Proteins
  104654717 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 104654717
NCBI-ProteinID: XP_010352282
UniProt: A0A2K6R6Z1
LinkDB
Position
19
AA seq 1090 aa
MSPWAIALCSAHCSASYLGFQFDKKRLPVEESEGKKEELAHSCLGGCGRRKMARALCPLQ
ALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDSHGRVAIVVG
APRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVV
SWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVEN
NFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRPGILLWHVSS
QSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILGSYYQRLH
RLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPH
TLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQVLVFLGQSEG
LSSRPSQVLESPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASV
QLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQLDRQKPRQG
RRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSLNVSLPPTEA
GMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLKLQMDTA
NEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNTQ
IGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPAS
LVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQHSDLLYIVNI
QPQGGLQCFPQPPVNPRKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLV
SCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAWFNVSSLPYA
VPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
PLEEDDEEGE
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgagtccatgggctatagccctttgctctgcccattgctcagcaagttacttggggttc
cagtttgataagaaaagacttcctgtggaggaatctgaagggaagaaggaggagctggcc
cattcctgcctgggaggttgtggaagaaggaagatggccagagctttgtgtccactgcaa
gccctctggcttctggagtgggtgctgctgctcttgggaccttgtgctgcccctccagcc
tgggccttgaatctggacccagtgcatctcaccttctatgcaggccccaatggcagccac
tttgggttttcactggacttccacaaggacagccatgggagagtggccatcgtggtgggc
gccccacggaccctgggtcccagccaggaggagacgggcggcgtgttcctgtgcccctgg
agagccgagggcggccagtgcccctcgctactctttgacctccgtgatgagacccgaaat
gtaggctcccagactttacaaaccttcaaggcccgccaaggactaggggcgtcggtcgtc
agctggagcgacgtcattgtggcctgcgccccctggcagcactggaacgtcctagaaaag
accgaggaggctgagaagacgcccgtaggcagctgctttttggctcagccagagagcggc
cgccgcgccgagtactccccctgtcgcgggaacaccctgagccgcatttacgtggaaaat
aattttagctgggacaagcgttactgtgaagcgggcttcagctccgtggtcactcaggcg
ggggagctggtgcttggggctcctggaggctattatttcttaggtctcctggcccaggct
ccaattgcggatattttctcgagttaccgcccaggcatccttttgtggcacgtgtcctcc
cagagcctctccttcgactccagcaacccagagtatttcgacggctactgggggtactcg
gtggctgtgggcgagttcgacggggatctcaacactacagagtatgtcgtcggtgccccc
acttggagctggacgctgggagcggtggaaattttgggctcctactaccagaggctgcac
cggctacacggagagcagatggcttcgtattttgggcattcagtggctgtcactgacgtc
aacggggatgggaggcatgacctgctggtgggcgctccactgtatatggaaagccgggca
gaccgaaaactggccgaagtggggcgtgtgtatttgttcctgcagccgcgaggcccccac
acgctgggtgcccccagcctcctgctgactggcacacagctctatgggcgattcggctct
gccatcgcacccctgggcgacctcgaccaggatggctacaatgacattgcagtggctgcc
ccctacgggggtcccagtggccggggccaagtgctggtgttcctgggtcagagtgagggg
ctgagttcacgtccctcccaggtcctggaaagccccttccccacaggctctgcctttggc
ttctcccttcgaggtgccgtagacatcgatgacaacggatacccagacctgattgtggga
gcttacggggccaaccaggtggctgtgtacagagctcagccagtggtgaaggcctctgtc
cagctactggtacaagattcactgaatcctgctgtgaagagctgtgtcctaccccagacc
aagacacccgtgagctgcttcaaaatccagatgtgtgttggagccactgggcacaacatt
cctcagaagctgtccctaaatgccgagctgcagttggaccggcagaagccccgccagggc
cggcgggtgctgctgctgggctctcaacaggcaggcaccaccctgaacctggatctgggc
ggaaagcacagccccatctgccacaccaccatggccttccttcgagatgaggccgaattc
cgggacaagctgagccccattgtgctcagcctcaatgtgtccctgccgcccacggaggct
ggaatggcccctgctgtcgtgctgcatggagacacccatgtgcaggagcagacacgaatc
gtcctggactgcggggaagatgacgtgtgtgtgccccagcttcagctcactgccagcgtg
acaggctccccgctcctagttggggcagataatgtcctgaagctgcagatggacacagcc
aacgagggcgagggggcctatgaagcagagctggccgtgcatctgccccagggggcccac
tacatgcgggccctaagcaacgtcgagggctttgagagactcatctgtaaccagaagaag
gagaatgagaccagggtggtgctgtgtgagctgggcaatcccatgaagaagaacacccag
ataggaatcgcgatgttggtgagcgtggggaatctggaagaggctggggagtctgtgtcc
ttccagctgcagatccggagcaagaacagccagaatccaaacagcaagattgtgctgctg
gatgtgccagtccgggcagaggcccaagtggagctgcgagggaactcctttccagcctcc
ctggtggtggctgcagaagaaggtgacagggagcagaacagcttggacagccggggaccc
aaagtggagcacacctatgagctccacaacaatggccctgggactgtgaatggccttcac
ctcagcatccacctcccggggcagtcccagcactccgacctgctctatatcgtgaatata
cagccccaggggggccttcagtgcttcccacagcctcctgtcaacccccgcaaggtggac
tgggggctgcccacccccagcccctcccccattcacccagcccatcacaagcgggatcgc
agacagatcttcctgccagagcccgagcagccctcgaggcttcaggatccagttctcgta
agctgcgactcggcgccctgtactgtggtgcagtgtgacctgcaggagatggcgcgcggg
cagcgggccatggtcacggtgctggctttcctgtggctgcccagtctccaccagaggcca
ctggatcagtttgtgctgcagtcacaggcatggttcaacgtgtcctccctcccctacgct
gtgcccccgctcagcctgccacgaggggaagctcaggtgcggacacagctgcttcgggcc
ttggaggagagggccattccaatctggtgggtgctggtgggtgtgctgggcggcctgctg
ctgctcaccatcctggtcctggccatgtggaaggtgggcttcttcaagcggaaccggcca
cccctggaagaagatgatgaagagggggagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662593
Entry
104662593         CDS       T03989                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11
  KO
K06587  integrin alpha 11
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104662593 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104662593 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104662593 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104662593 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104662593 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104662593 (ITGA11)
   05414 Dilated cardiomyopathy
    104662593 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104662593 (ITGA11)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104662593 (ITGA11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N
Other DBs
NCBI-GeneID: 104662593
NCBI-ProteinID: XP_010361935
UniProt: A0A2K6PJN4
LinkDB
Position
5
AA seq 1233 aa
MSRCCQGARSPAQCRLQAPRRGGCRSGSPPPRRRCTPDPTAAPRAMDLPRGLVVAWALSL
WPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGKKWLVVGAPLETNGHQKTGDVYK
CPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYT
TGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIG
PGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQ
KGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLN
EIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHV
VEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKNHGAYLGYTVTSVVSS
RQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQALRGQQIGSYFGSEITSVDIDGNGVT
DVLLVGAPMYFSEGRERGKVYVYELRQNRFVYNGTLKDSHSYQNARFGSSIASVRDLNQD
SYDDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLN
EDGLIDLAVGALGNAVVLWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCF
TPVFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFH
VLDTADYVKPVTFSAEYSLEDPDHGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLVLDA
RSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAVEATLENRGENAYSTV
LNISQSANLQFASLIQKEDSDGNIECVNEERRLQKKVCNVSYPFFRAKAKVAFRLDFEFS
KSIFLHHLEIELAAGSDSNEQDSTKEDNVAPLRFHLKYEADVLFTRRSSLSHYEVKPNSS
LERYDGIGPPFSCIFRIQNLGLFPIHGVMMKITVPIATRGGNRLLKLRDFLTDQANTSCN
IWGNSTEYRPTPMEEDLSRAPQLNHSNSDVVSINCNIRLAPNQEINFHLLGNLWLRSLKA
LKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLL
LALLVLALWKLGFFKSARRRREPGLDPTPKVLE
NT seq 3702 nt   +upstreamnt  +downstreamnt
atgagccgctgctgtcagggagcccggagccccgcgcagtgcaggctgcaggcgccgcgc
cgaggaggctgccgctctggctcgccgcccccccgccgccgctgcacaccggaccccacc
gccgcaccgcgggccatggacctgcctaggggcctggtggtggcctgggccctcagcttg
tggccagggttcacggacaccttcaacatggacaccaggaagccccgggtcatccctggc
tccaggaccgccttctttggctacacagtgcagcagcatgatatcagtggcaagaagtgg
ctggtcgtgggcgccccactggaaaccaatggccaccagaagacgggagacgtgtacaag
tgtccagtgatccacgggaactgcaccaaactcaacctgggaagggtcaccctgtccaac
gtgtccgagcggaaggacaacatgcgcctcggccttagtctcgccaccaaccccaaggac
aacagcttcctggcctgcagccccctctggtctcacgagtgtgggagctcctactacacc
acaggaatgtgttcaagagtcaactccaacttcaggttctccaagaccgtggccccagct
ctccaaaggtgccagacctacatggacatcgtcattgtcctggatggctccaacagcatc
tacccctgggtggaggttcagcacttcctcatcaacatcctgaagaagttttacattggc
ccagggcagatccaggttggagtcgtgcagtatggagaagatgtggtgcatgagtttcac
ctcaatgactacaggtctgtaaaagacgtggtggaagctgccagccacattgagcagaga
ggaggaacagagacccggacagcatttggcatcgaatttgcacgctcagaggctttccag
aagggcggaaggaaaggggccaagaaggtgatgattgtcatcacagacggagagtcccac
gacagcccagacctggagaaggtgatccagcaaagcgagagagacaacgtaacaagatat
gcagtggccgtcctgggctactacaaccgcagggggatcaatccagaaacttttctaaat
gaaatcaaatacatcgccagtgaccccgatgacaagcacttcttcaatgtcactgatgag
gctgccttgaaggacattgtcgatgccctgggggacagaatcttcagcctggaaggcacc
aacaagaacgagacctcctttgggctggagatgtcgcagacaggcttttcctcgcatgtg
gtggaggatggggttctgctgggagccgttggtgcctatgactggaacggagctgtgcta
aaggagacgagtgccggcaaggtcattcctctccgcgagtcctacctgaaagagttcccc
gaggagctcaagaaccacggtgcatacctggggtacacagtcacatcggtcgtgtcctcc
aggcaggggcgggtgtatgtggccggagccccccggttcaaccacacaggcaaagtcatc
ctgttcaccatgcacaacaaccggagcctcaccatccaccaggctctgcggggccagcag
ataggctcttactttgggagtgagatcacctcggtggacattgacggcaatggtgtgact
gatgtcctgctggtgggtgcacccatgtacttcagcgagggccgcgagcgaggcaaggtg
tacgtctacgagctgagacagaaccggtttgtttataacggaacgctcaaggattcacac
agttaccagaatgcccggtttgggtcctccattgcctcagttcgagacctcaaccaggat
tcctatgacgatgtggtggtgggagcccccctcgaggacaaccacgcaggagccatctac
atcttccacggcttccgaggcagcatcctgaagacacctaagcagagaatcacagcctca
gagctggctaccggcctccagtattttggctgcagcatccacgggcaattggacctcaat
gaggatgggctcatcgacctggcagtgggagcccttggcaacgctgtggttctctggtcc
cgccctgtggttcagatcaatgccagcctccactttgagccatccaagatcaacatcttc
cacagagactgcaagcgcagtggcagggatgccacctgcctggccgccttcctctgcttc
acgcccgtcttcctggcaccccacttccaaacgacaactgttggcatcagatacaatgcc
accatggacgagaggcggtatacaccgagggcccacctggacgagggcggggaccgattc
accaacagagctgtcctgctctcctccggccaggagctctgtgagaggatcaacttccat
gtcctggacactgctgactacgtgaagccagtgaccttctcagccgagtattccctggag
gaccctgaccatggccccatgctggacgacggctggcccaccactctcagagtctcggtg
cccttctggaacggctgcaatgaggatgagcactgtgtccctgaccttgtgctggatgcc
cggagtgacctgcccacggccatggagtactgccagagggtgctgaggaagcctgcgcag
gactgctccgcatacacgctgtccttcgacaccacagttttcatcatagagagcacacgc
cggcgagtggcagtggaggccacactggagaacaggggcgagaacgcctacagcacagtc
ctaaatatctcacagtcagcaaacctgcagtttgccagcttgatccagaaggaggactcg
gacggtaacatcgagtgtgtgaatgaggagaggaggctccagaagaaagtctgcaacgtc
agctaccccttcttcagggccaaggccaaggtggctttccgtcttgattttgagttcagc
aaatccatcttcctacaccacctggagatcgagctcgctgcaggcagtgacagtaacgag
caggacagcaccaaggaagacaacgtggcccctctacgcttccacctcaaatacgaggct
gacgtcctcttcaccaggaggagcagcctgagccactacgaggtcaagcccaatagctca
ctggagagatacgatggtatcgggcctcccttcagctgcatcttcaggatccagaacttg
ggcttgttccccatccacggggtaatgatgaagatcaccgttcccatcgccaccaggggc
ggcaaccgcctgctgaagctgagggacttcctcaccgatcaggcgaacacgtcctgtaac
atctgggggaacagcactgagtaccggcccaccccaatggaggaagacttgagtcgtgct
ccgcagctgaatcacagcaactctgatgtcgtctccatcaattgcaatatacggctggcc
cccaaccaggaaatcaatttccatctactgggaaacctgtggttgaggtccctaaaagca
ctcaagtacaaatccatgaaaatcatggtcaacgcagccttgcagaggcagttccacagc
cccttcatcttccgtgaggaggatcccagccgccagatcgtgtttgagatctccaagcaa
gaggactggcaggtccccatctggatcattgtaggcagcaccctggggggcctcctgctg
ctggccctgctggtcctggcactgtggaagctcggcttcttcaaaagtgccaggcgcaga
agggagcctggtctggaccccacccccaaagtgctggagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664159
Entry
104664159         CDS       T03989                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8 isoform X1
  KO
K06584  integrin alpha 8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104664159 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104664159 (ITGA8)
   04514 Cell adhesion molecules
    104664159 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104664159 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104664159 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104664159 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104664159 (ITGA8)
   05414 Dilated cardiomyopathy
    104664159 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104664159 (ITGA8)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104664159 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 104664159
NCBI-ProteinID: XP_010363907
UniProt: A0A2K6RPE7
LinkDB
Position
11
AA seq 1063 aa
MSPGASRGPRGSRTPLIAPLCCAAAALGMMLWSPASEAFNLDVEKLTVYSGPEGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEHIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTIVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIVNLENKTCQVPDSMTSAACFSLRVCASVAGQSISNTIVLMA
EVQLDSLKQKGAIKRTLFLDNHQAHRVFPLVIKWQKSHQCQDFVVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENVVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVARLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQTNPNINPQDIKPAASPEDTPELSAFLRNSTIP
HLVRKRDVPVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDREQLTNDKTPEA
NT seq 3192 nt   +upstreamnt  +downstreamnt
atgtcgcccggggccagccgcggtccccgaggaagccggacgccgctgatcgcgcctctc
tgctgcgctgcggcggcgctggggatgatgttgtggtctcctgcctcggaggcgttcaac
ctggacgtggaaaagctcacggtgtacagcggccccgagggcagctacttcggctacgct
gtggacttccacatacctgacgcccgcacagcgagtgtcttggtgggggcgcccaaagcc
aacaccagccagcccgacatcgtggaagggggagccgtctattactgtccttggcccgcg
gaggggtctgcgcagtgcaggcagataccgtttgacaccaccaacaacagaaaaatcaga
gttaatggaaccaaagaacatattgagtttaaatccaatcagtggtttggagcaacagtg
aaagctcacaaaggaaaagttgtggcctgtgctcctttatatcactggagaactcttaaa
ccgacaccagaaaaagacccagttggcacctgctatgtagcaattcagaacttcagcgcc
tatgccgagttctctccttgccggaacagcaatgctgatccggaagggcagggttactgc
caagcaggatttagtctggatttttataagaatggagaccttattgtgggaggacctggg
agtttctactggcaagggcaagtgatcactgccagtgttgcagatatcattgcaaattac
tcattcaaggatatcctcagaaaactggcaggagaaaagcagacagaagtggctccagct
tcctatgatgacagttaccttggatactcagttgctgctggggagtttactggggattct
cagcaagaattggttgctggagttccaagaggagcacagaattttggatatgtttcaatc
attaactctacagatatgacgtttattcagaatttcactggcgaacagatggcatcttat
tttggatataccattgtcgtatcagatgttaacagtgatggactggatgatgtcctggtt
ggggcacctctctttatggaacgtgaatttgagagcaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctccctcctcttcagagacccccagatccttactggcact
gagacatttgggagattcggaagtgctatggcgcacttaggagacctgaaccaagatgga
tacaatgacattgccatcggcgtgccttttgcaggcaaggatcaaagaggcaaagtgctc
atttataatgggaacaaagacggcttaaacacaaagccttcccaagttctgcaaggagtg
tgggcctcacacgctgtcccttctggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatttgattgtgggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccggttgtgactgtagatgcccagcttctgctgcacccaatgattgtc
aatcttgaaaataaaacttgccaggttccagactctatgacttctgcagcctgcttttct
ttaagagtatgtgcatctgtcgcaggccagagcatttcaaacacaatagtcttaatggca
gaggtgcaattagattccctgaaacagaaaggagccattaaacgaacgctcttccttgat
aaccatcaggctcatcgtgtcttccctcttgtgataaaatggcagaaatcccaccaatgc
caggatttcgtcgtttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggacgaatccacctttaaggaaggcctggaagtgaaa
ccaatattgaactactacagggaaaacgttgttagtgaacaggctcacattctggtagac
tgtggagaagacaatctgtgtgttcctgacttgaagctgtcagctagaccagataagcat
caggtaatcattggagatgaaaatcaccttatgctcataataaatgcaagaaatgaaggg
gaaggagcatatgaagctgaactctttgtaatgataccagaagaggcagattatgttggg
atcgaacgcaacaacaagggatttcgaccactgagctgtgagtacaagatggaaaatgta
accaggatggtggtgtgtgaccttgggaaccctatggtgtctggaacaaattattccctg
ggcctccgatttgcagttgcacgtctcgagaaaacaaacatgagcattaacttcgatctc
caaatcagaagttccaacaaggacaatccagacagcaattttgtgagcctgcaaatcaac
atcactgctgtagcacaggtggaaataagaggagtgtcacaccctccgcagattgttcta
cccattcataactgggaaccagaagaggagccccacaaagaggaagaggttggaccattg
gtggaacatatttacgagctgcacaatattggacccagtaccatcagtgacaccatcctg
gaggtgggctggcctttctctgcccgggatgaatttcttctctacattttccatattcaa
actctgggacctctgcagtgccaaacaaatcctaatatcaatccacaggatataaagcct
gctgcctccccagaggacacccctgagctcagcgcctttttgcgaaactctaccattcct
catcttgtcaggaagagggatgtgcccgtggtcgaattccacagacagagccctgcaaaa
atactgaattgtacaaatatcgagtgtttacaaatctcctgtgcagtgggacgactcgaa
ggaggagaaagcgcagtcctgaaagtcaggtcacgattatgggcccacaccttcctccag
agaaaaaatgatccctatgctcttgcatccctggtgtcctttgaagttaagaagatgcct
tataaagaccagccagcaaaactcccagaaggaagcatagcaattaagacatcagttatt
tgggcaactccgaatgtttccttctcaatcccattatgggtaataatactagcaatactt
cttggattgttggttctggccattttaaccttagctttatggaagtgtggattctttgac
agagccagacctcctcaggaggacatgaccgacagggaacagctgacaaatgacaagacc
cccgaggcatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104666588
Entry
104666588         CDS       T03989                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04640  Hematopoietic cell lineage
rro04670  Leukocyte transendothelial migration
rro04672  Intestinal immune network for IgA production
rro04810  Regulation of actin cytoskeleton
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104666588 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104666588 (ITGA4)
   04514 Cell adhesion molecules
    104666588 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104666588 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104666588 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104666588 (ITGA4)
   04670 Leukocyte transendothelial migration
    104666588 (ITGA4)
   04672 Intestinal immune network for IgA production
    104666588 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104666588 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104666588 (ITGA4)
   05414 Dilated cardiomyopathy
    104666588 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104666588 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104666588 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    104666588 (ITGA4)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104666588 (ITGA4)
  Exosomal proteins of other cancer cells
   104666588 (ITGA4)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104666588 (ITGA4)
CD molecules [BR:rro04090]
 Proteins
  104666588 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 104666588
NCBI-ProteinID: XP_010366985
UniProt: A0A2K6NH15
LinkDB
Position
14
AA seq 1032 aa
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPPNTLFGYSVVLHS
HGANRWLVVGAPTANWLANASVINPGAIYRCRIGKNPGRTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNEMETNLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGVSSAFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKTESPPRFYFSSNGT
SDVMTGSIQVSSGVANCRTHQAFMRKDVRDIRTPIQIEAAYHLGPHVISKRSTEEFQPLQ
PILQQKKEKDIIKKTISFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGGMKTLMLN
VSLFNAGDDAYETTLHVRLPMGLYFIKILELEEKQITCEVTDNSGMVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLNITVHATCENEGEMDSLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPEMCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMHTLKGMFQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNSRVIELNKDENVA
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcttgggaagcgaggcgcgaacctggtccccgaagggccgccgtccgggagacggtg
atgctgttgctgtgcctgggggtcccgaccggccgcccctacaacgtggacactgagagc
gcgctgctttaccagggcccccccaacacgctgttcggttactcggtcgtgctgcacagc
cacggggcgaaccgatggctcgtggtgggtgcgcccactgccaactggctcgccaacgct
tcagtgatcaatcccggggcgatttacagatgcaggatcgggaagaatcccggccggacg
tgcgaacaactccagctgggtagccctaatggagaaccttgtggaaagacttgtttggaa
gagagagacaatcagtggttgggggtcacactttccagacagccaggagaaaatggatcc
atcgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccactggtggttgctatggaatgccccctgatttacgaacagaactgagtaaaagaata
gctccgtgttatcaagattatgtgaaaaaatttggagaaaattttgcgtcatgtcaagct
ggaatatctagtttttacacaaaggatttaattgtgatgggagccccaggatcatcttat
tggactggctctctttttgtctacaatataactacaaataaatacaaggcttttttagac
aaacaaaatcaagtaaaatttggaagttatttaggatattcagttggagctggtcatttt
cggagtcagcatactactgaagtagtcggaggagctcctcaacacgagcagattggtaaa
gcatatatattcagcattgatgaaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttggatcgtactttggagcttctgtctgtgctgtggaccttaacgcagatggcttc
tcagatctgcttgtgggagcgcccatgcagagcaccatcagagaggaaggaagagtgttt
gtgtacatcaactctggctcgggagcagtaatgaatgaaatggaaacaaacctcgttgga
agtgacaaatatgctgcaagatttggcgaatctatagttaatcttggtgacattgacaat
gatggctttgaagatgttgctatcggagctccacaagaagatgacttgcaaggtgctatt
tatatttacaatggccgagcagatggggtctcatcagccttctcgcagagaattgaagga
cttcagatcagcaaatcgttaagtatgtttggacagtctatatcaggacaaattgatgca
gataataatggatatgtagatgtagcagttggtgcttttcggtctgattctgctgtgttg
ctaaggacaagacctgtagtcattgttgaagcttctttaagccaccctgagtcagtaaat
agaacaaaatttgactgtgttgaaaatggatggccttctgtgtgcatggatctaacactg
tgtttctcatataagggcaaggaagttccaggttacattgttttgttttataacatgagt
ttggatgtgaacagaaagacagagtctccaccaagattctatttttcttctaatggaact
tctgacgtgatgacaggaagcatacaagtgtctagtggagtagctaactgtagaacacat
caagcatttatgcggaaagatgtgcgggacatccgcaccccaattcagattgaagctgct
taccaccttggtcctcacgtcatcagtaaacgaagcacagaagaattccaaccacttcag
ccaattcttcagcagaagaaagaaaaagacataattaaaaaaacaataagctttgcaagg
ttttgtgcccatgaaaattgttctgctgatttacaggtttctgcaaagattgggtttttg
aagccccatgaaaataaaacctaccttgctgttgggggtatgaagacattaatgttgaat
gtgtccttgtttaatgctggagatgatgcatatgaaacgactctacatgtcagactacct
atgggtctttacttcattaagattttagagctggaagagaagcaaataacctgtgaagtc
acagataactctggcatggtacaacttgactgcagtattggctatatatatgtagatcat
ctctcaaggatagatattagctttctcctggatgtgagctcactcagcagagcagaagag
gacctcaatatcacagtgcatgctacctgtgaaaatgaaggggaaatggacagtctaaag
cacagcagagtgactgtagcaatacctttaaaatatgaggttaagctgactgttcatggg
tttgtaaacccaacttcatttgtgtatggatcaaatgatgaaaatgagcctgaaatgtgc
atggtggagaaaatgaacttaactttccatgttatcaacactggcaatagcatggctcct
aatgttagtgtggaaataatggtaccaaattctttcagcccccaaactgataagctgttc
aacattttggatgtccagactactactggagaatgccactttgaaaattatcaaagagta
tgtgcattagagcagcaaaagagtgcaatgcacaccttgaaaggcatgttccagttcttg
tccaagactgataagaggctattgtactgcataaaagctgatccacattgtttaaatttc
ctatgtaatttcgggaaaatggaaagtggaaaagaagccagtgttcatatccagttggaa
ggccgaccatccattttagaaatggatgagacttcagcactcaaatttgaaatacgagca
acaggttttccagagccaaattcaagagttattgaactaaacaaggatgagaatgttgca
catgttctactggaaggactacatcatcaaagacccaaacgttatttcaccatagtgatt
atttcaagtagcttgctacttggacttattgtacttctgttgatctcatatgttatgtgg
aaggccggcttctttaaaagacaatacaaatctatcctacaagaagaaaacagaagagac
agctggagttacatcaacagtaaaagcaatgatgattaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667754
Entry
104667754         CDS       T03989                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V isoform X2
  KO
K06487  integrin alpha V
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04810  Regulation of actin cytoskeleton
rro04919  Thyroid hormone signaling pathway
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104667754 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104667754 (ITGAV)
   04514 Cell adhesion molecules
    104667754 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104667754 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104667754 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104667754 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104667754 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667754 (ITGAV)
   05205 Proteoglycans in cancer
    104667754 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104667754 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667754 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    104667754 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104667754 (ITGAV)
   05414 Dilated cardiomyopathy
    104667754 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104667754 (ITGAV)
   05165 Human papillomavirus infection
    104667754 (ITGAV)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    104667754 (ITGAV)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104667754 (ITGAV)
  Exosomal proteins of epithelial cells
   104667754 (ITGAV)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104667754 (ITGAV)
CD molecules [BR:rro04090]
 Proteins
  104667754 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 104667754
NCBI-ProteinID: XP_010368605
UniProt: A0A2K6NBD3
LinkDB
Position
14
AA seq 1048 aa
MASPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTELKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSIYNFTGD
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFFYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYWLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVFVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctggacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacacgacccagcctgggatt
gtggaaggagggcaagtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggacgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaagataaaattttggcctgtgcccca
ttgtaccattggaggactgagttgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgcagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatatgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagttatttgggttactctgtggctgttggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccatatacaattttactggcgat
cagatggctgcatatttcgggttttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccag
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacaacaaag
ctgaatgggtttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaatcgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgctttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccagaaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttttctacagcaggtccccaagtcactccaagaacatgactatttcaagaggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattaccatttttatggaatattggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttttgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctatgaagctgagctcattgtttccattccactgcag
gctgatttcatcggggttgtccgaaacagtgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgaccttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatatctttcttcccattccaaactgggagcacaaggagaaccccgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccgagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataacaataacactttgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatttcatctttgcaaacaactgaaaagaatgacacagttgctgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagtcgctcagtgcttgaagattgtctgccaagttggaagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacctttatgaat
aaagaaaatcagaatcattcctattctctgaagtcatctgcttcatttaatgtcatagag
tttccttataaaaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcacccatgcctgtgcctgtgtgggtgatcattttagca
gttcttgcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaggaacaagaaagggaacaacttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670562
Entry
104670562         CDS       T03989                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05100  Bacterial invasion of epithelial cells
rro05133  Pertussis
rro05135  Yersinia infection
rro05165  Human papillomavirus infection
rro05168  Herpes simplex virus 1 infection
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104670562 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104670562 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104670562 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670562 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104670562 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104670562 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104670562 (ITGA5)
   05205 Proteoglycans in cancer
    104670562 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104670562 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104670562 (ITGA5)
   05414 Dilated cardiomyopathy
    104670562 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104670562 (ITGA5)
   05133 Pertussis
    104670562 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    104670562 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104670562 (ITGA5)
   05165 Human papillomavirus infection
    104670562 (ITGA5)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104670562 (ITGA5)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104670562 (ITGA5)
CD molecules [BR:rro04090]
 Proteins
  104670562 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 104670562
NCBI-ProteinID: XP_010372165
UniProt: A0A2K6RWN5
LinkDB
Position
10
AA seq 1098 aa
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTPESPLH
AVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNFDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVAATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDVGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKC
PEAECLRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgccagagtcccctctccac
gccgtgcagctgcgctggggcccccggcgccgacccccgctgctgccgctgctgctgctg
ctgctgccgccgccacccagggtcgggggcttcaactttgacgcggaggccccagcagtg
ctctcggggcccccgggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctggtgggagcgcccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggtgccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcatgcgctccactgtacagctggcgcacagagaaggagccactcagcgac
cctgtgggtacctgctacctctccacagataacttcacccgaattctggagtatgcacct
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagtgct
gagttcactaagactggtcgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttactaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgtaggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatc
cgatccctctacaacttctcaggggaacagatggcctcctacttcggctatgcagtggct
gccacagacatcaatggggacgggctggatgacttgctggtgggggcaccgctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacgtctacctgcagcac
ccagccggcatagagcccacgcccacccttaccctcactggtcatgatgagtttggccga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
attggggctccctttggtggggagacccagcagggagtagtgtttgtattccctgggggc
ccaggagggctgggctctaagccttcccaggttctgcaacccctgtgggcagccagtcac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaacggatac
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacaggggccgcccc
atcgtgtctgccagtgcctccctcaccatcttccctgccatgttcaacccagaggagcgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacacgttgctgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaatgagtcagaatttcgagacaaactctccccgattcacatcgctctcaacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctacattaccagagc
aagagccggatagaggacaaggctcagatcttgctggactgtggagaagacaacatctgt
gtgcctgacctgcagctggaagtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctgaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtgaccgcccctccagaggctgagtactcaggactcgtcagacatccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagcgacgtggtttccttccggctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctctaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacgtgggacctgctgtgcaccatgtctatgag
ctcatcaaccaaggccccagctccattagccagggcgtgctggagctcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttacgggactcaactgcaccacc
aatcaccccattaacccaaagggcctggagttggatcccgagggttccctgcaccaccgg
caaaaacgggaagctccaagccgcagctctgcttcctctggacctcagatcctgaaatgc
ccggaggctgagtgtttgaggctgcgctgcgagctcgggcccctgcaccaacaagagagc
caaagtctgcagctgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcggcagctgccccaaaaggagcgtcaggtggccacagctgtgcaatggaccaaggca
gaaggcagctatggtgtcccactgtggatcatcatcctagccatcctttttggcctcctg
ctactaggtctactcatctacatcctctacaagctcggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671046
Entry
104671046         CDS       T03989                                 

Gene name
ITGA10
Definition
(RefSeq) integrin alpha-10 isoform X1
  KO
K06586  integrin alpha 10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104671046 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104671046 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104671046 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104671046 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104671046 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104671046 (ITGA10)
   05414 Dilated cardiomyopathy
    104671046 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104671046 (ITGA10)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104671046 (ITGA10)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 104671046
NCBI-ProteinID: XP_010372745
UniProt: A0A2K6QL11
LinkDB
Position
8
AA seq 1230 aa
MAQSFPWSGAPHSSPPSLLPFLPTLFLAAIGRGQDGRESKENRKGEGRTEARGLLIPDRN
RSGMELPLITHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHIGGGQRWML
VGAPWDGPSGDRRGDVYRCPVGGAHDAPCAKSHLGDYQLGNSSHPAVNMHLGMSLLETDG
DGGFMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNS
IYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSR
REGRETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEKLPAALKTCEAGRV
TRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGL
EGTHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHHLFPPRMALE
DEFPSALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSL
QGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQG
TLQPEPPQDARFGFAMSALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQ
RIAAASMSHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLAPSLEVTPQ
AISVVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDRRFYMKFTASLDEWTAGARAAFDG
SGQRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVAFTVTFALDNTTKPGPVLDEGSPT
SIQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKALVSATLENRKENA
YNTSLSLIFSRNLHLASLTPQRDSPIKVECAAPSTHARLCIVGHPVFQTGAKVTFLLEFE
FSCSSLLSQVFVKLTASSDSLERDGTLRDNTAQTSAHIQYEPHLLFSSESTLHRYEVHPY
GTLPVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCTVQ
NLTEPPAPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRA
KFKSLMVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLL
ALLVFCLWKLGFFAHKKIPEEEKREEKLEQ
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggctcagtcctttccttggtctggggctccccacagttccccaccatcactcctccca
ttccttccaactttatttttagctgccattgggagggggcaggatgggagggaaagtaaa
gaaaacagaaaaggagagggacggacagaggccagaggacttctcataccggacagaaac
cgatcaggcatggaactccccctcatcactcacctgttcttgcccctggtgttcctgaca
ggtctctgctccccctttaacctggatgaacatcacccacgcctattcccagggccacca
gaagctgaatttggatacagtgtcttacaacatattgggggtggacagcgatggatgctg
gtgggcgccccctgggatgggccttcaggcgaccggaggggggatgtttatcgctgccct
gtagggggggcccacgatgccccatgtgccaagagccacttaggtgactaccaactggga
aattcatctcatcctgctgtgaatatgcacctggggatgtctctgttagagacagatggt
gatgggggattcatggcctgtgcccctctctggtctcgtgcttgtggcagctctgtcttc
agttctgggatatgtgcccgtgtggatgcttcattccggcctcagggaagcctggcaccc
actgcccaacgctgcccaacatacatggatgttgtcatcgtcttggatggctccaacagc
atctacccctggtctgaagttcagaccttcctacgaagactggtagggaaactgtttatt
gacccggaacagatacaggtgggactggtacagtatggggagagccctgtacatgagtgg
tccctgggagatttccgaacgaaggaagaagtggtgagagcagcaaagaacctcagtcgg
cgggagggacgagaaacaaagactgcccaagcaataatggtggcctgcacagaagggttc
agtcagtcccatgggggccgacccgaggctgccaggctactggtggttgtcactgatgga
gagtcccatgatggagagaagcttcctgcagcactgaagacctgtgaggctggaagagtg
acacgctatgggattgcagtccttggtcactacctccggcggcagcgagatcccagctct
ttcctgagagaaattagaactattgccagtgatccagatgagcgattcttcttcaatgtc
acagatgaggctgctctgactgacattgtggatgcactaggagatcggatttttggcctc
gaagggacccatgcagaaaatgaaagctcctttgggctggaaatgtctcagattggtttc
tccactcatcggctaaaggatgggattctctttgggatggtgggggcctatgactggggg
ggctctgtgctatggcttgaaggaggtcaccaccttttccccccacgaatggctctggaa
gacgagttcccctctgcattgcagaaccatgcagcctacctgggttactctgtttcttcc
atgcttttgcggggtggacgccgcctgtttctctctggggctcctcgatttagacatcga
ggaaaagtcatcgccttccagcttaagaaagatggggctgtgagggttgcccagagcctc
cagggggagcagattggttcatactttggcagtgagctctgcccattggatacagatagg
gatggaacaactgatgtcttacttgtggctgcccccatgttcctgggaccccagaacaag
gaaacaggacgtgtttatgtgtatctggtgggccagcagtccttgctgaccctccaagga
acacttcagccagaacccccccaggatgctcggtttggctttgccatgagtgctcttcct
gatctgaaccaagatggttttgctgatgtggctgtgggggcacctctggaggatgggcac
cagggagcactgtacctgtaccatggaacccagagtggagtcaggccccatcctgcccag
aggattgctgctgcctccatgtcacatgccctcagctactttggccgaagtgtggatggc
cggctagatctggatggagatgatctggtcgatgtggctgtgggtgcccagggggcagcc
atcctgctcagctcccggcccattgtccatctggccccatcactggaggtgactccacag
gccatcagtgtggttcagagggactgtaggcggcgaggccaggaggcagtctgtctgact
gcagccctctgcttccaagtgacctcccgtactcctggtcgctgggatcgccgattctac
atgaagttcacagcatcactggatgaatggacggctggggcacgtgcagcatttgatggc
tctggccagaggctgtcccctcggaggctccgactcagtgtggggaatgtcacttgtgag
cagctacacttccatgtgctggatacatcagattacctccggcctgtggcctttaccgtg
acctttgccttggacaataccacaaagccagggcctgtgctggatgagggctcacccacc
tctatacaaaagctggtccccttctcaaaggattgtggccctgacaatgaatgtgttaca
gacctggtgcttcaagtgaatatggacatcagaggctccaggaaggccccatttgtggtt
cgaggtggccggcggaaagcgctggtatctgcaactctggagaacaggaaggaaaatgct
tacaatactagcctgagtctcatcttctctagaaacctccacctggccagtctcactcct
cagagagacagcccaataaaggtggaatgtgcagccccttctactcatgccaggctctgc
attgtggggcatcctgtcttccagactggagccaaggtgacctttctgctagagttcgag
tttagctgctcctctctcctgagccaagtcttcgtgaagctgacggccagcagtgacagc
ctggagagagatggaacccttcgagataacacagcccagacctcagcccacatccaatat
gagccccatctcctcttctctagtgagtctaccctgcaccgctatgaggttcacccatat
gggaccctcccagtgggtcctggcccagaattcaaaaccactcttagggttcagaaccta
ggctgctatgtggtcagtggcctcatcatctcagccctccttccagctgtggcccatggg
ggcaattacttcctatcactgtctcaagtcatcactaacaatgcaagctgcacagtgcag
aatctgactgaacccccagcaccccctgtgcatccagaggagcttcaacacacaaacaga
ttgaatgggagcaatactcagtgtcaggtggtgaggtgccaccttgggcagctggcaaag
gggaccgaggtctctgttggactattgaggctggttcacaatgaatttttccgaagagcc
aagttcaagtccctgatggtggtcagcacctttgagctgggaaccgaggagggcagtgtc
ctacagctgactgaagcctcccgttggagtgagagccttctggaggtggttcagacccgg
cctatcctcatctccctgtggatcctcataggcagtgtcctgggagggttgctcctgctt
gctctccttgtcttctgcctgtggaagcttggcttctttgcccataagaaaatccctgag
gaagaaaaaagagaagagaagttggaacaatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672477
Entry
104672477         CDS       T03989                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04611  Platelet activation
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104672477 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104672477 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104672477 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104672477 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104672477 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104672477 (ITGA2)
   04611 Platelet activation
    104672477 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672477 (ITGA2)
   05205 Proteoglycans in cancer
    104672477 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104672477 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104672477 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104672477 (ITGA2)
   05414 Dilated cardiomyopathy
    104672477 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104672477 (ITGA2)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104672477 (ITGA2)
  Exosomal proteins of bladder cancer cells
   104672477 (ITGA2)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104672477 (ITGA2)
CD molecules [BR:rro04090]
 Proteins
  104672477 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 104672477
NCBI-ProteinID: XP_030783442
LinkDB
Position
3
AA seq 1180 aa
MRPGRTGPSPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNVTVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILSQH
QFLEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTVRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADIAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETTKV
FSIPFHKDCGEDGLCIADLVLDVQQIPAAQEQPFTVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDIGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSVSFKSENFRHTKELNCRTASCSNVTCWLKDLHMKGEYFVNVTTRIWN
GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPIGVIIGSIIA
GILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgcggccaggacggacagggccctcgccactgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcatacaatgttggtctccctgaagcaaaaatattt
tctggtccttcaagtgaacagtttggctatgcagtgcagcagttcataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataagtgtcccgttgacctatccactgccacatgtgaaaaactaaatttgcagacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgaccctcaca
aggaacatgggaactggagggtttctcacatgtggtcctctgtgggcacagcagtgtggg
aatcagtattacacaacaggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcagctcagccctgcccttccctcatagatgttgtagttgtatgtgat
gaatcaaacagtatttatccttgggatgcagtgaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacatttggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtggacgacgaagtgctaccaaagtaatggtagtt
gtaactgatggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaatgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gttggattcagtgcagattactctcctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaggcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcacccactttgttgctggtgctcctcgggcaaat
tacaccggccagatagtgctgtacagtgtgaatgagaatggcaatgtcacagttattcag
gctcaccgaggtgaccagataggctcctatttcggtagcgtgctgtgttcagttgatgtg
gataaagacaccattacagatgtgctcttggtaggtgcaccaatgtacatgaatgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaaaagggcattttgagtcagcac
caatttcttgaaggccccgagggcattgaaaatgctcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaacgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttataatggtcatcagggcactgtccgcacgaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtccattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatatagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaataagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaataatcaagtggccattgtatataacatc
acccttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccctgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactaccaaggtc
ttcagtattcctttccacaaagactgtggtgaggatggactttgcattgctgatctagtt
ctagatgtccaacaaataccagctgctcaagaacaaccctttactgtcagcaaccaaaac
aaaaggttaacattttcagtaacactgaaaaacaaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgtgatgtaggctac
cctgctttaaagagagaacaacaggtgacctttactattaacttcgacttcaatcttcaa
aaccttcagaatcaggcatctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaatacctctcctgtacgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatattggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcaatataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttctgtatctttcaaaagtgaaaat
ttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgctgg
ttgaaagaccttcacatgaaaggagaatactttgttaatgtgactacaagaatttggaac
gggacttttgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatcaac
acctataaccctgagatatacgtgatcgaagataacactgttacgattcccctgatgata
atgaaacctgatgagaaagccgaagtaccaataggagttataataggaagtataatcgct
ggaatccttttgctgttagctctggttgcaattttatggaagcttggctttttcaaaaga
aaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagaactcaatagc
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672775
Entry
104672775         CDS       T03989                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104672775 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104672775 (ITGA9)
   04514 Cell adhesion molecules
    104672775 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104672775 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104672775 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104672775 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104672775 (ITGA9)
   05414 Dilated cardiomyopathy
    104672775 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104672775 (ITGA9)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104672775 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 104672775
NCBI-ProteinID: XP_030786600
LinkDB
Position
1
AA seq 1035 aa
MGGPAAPRGAGGLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTVKVLNLTDNTYLKLNDEVIM
NRRYTYLGYAVTAGHFSHASTTDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDDDGFPDVAIGAPKEDDFAGAVYIYHGDASGIVPQYSMKLSGRKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITMDVAIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFRGKHVPGEIGLNYVLTADVAKKEKGQLPRVYFVLLGETVG
QVTEKLQLTYMEETCHHYVAHVKRRVQDVISPIVFEAAYSLGEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCHSEDCAADLQLRGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNMERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEI
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgggcggcccggctgcgccgaggggcgccggggggctccgcgcgctgctgctggcgctg
gtggtcgcggggatccccgcgggcgcctacaacctcgacccgcagcgccccgtgcacttc
cagggccccgccgactcgttcttcggctacgcggttctggagcatttccacgacaacacg
cgctgggtccttgtgggtgcaccaaaggcagattccaaatacagcccttcagtgaagtct
cctggggctgtgtttaagtgccgtgttcacaccaaccctgaccggagatgcaccgaactg
gacatggctcgagggaagaatcggggcacgtcctgtggaaagacctgccgggaagaccgc
gatgatgagtggatgggggtgagcctggcccggcagccgaaagctgatggccgcgtgttg
gcctgtgctcatcgctggaagaacatctactatgaagctgaccacatcctaccccatggt
ttctgctacatcatcccttccaacctccaggccaaaggcaggacgctgatcccttgctat
gaagagtataagaagaaatacggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcaccgaggagctggtggtgatgggtgccccagggtcattttattgggctggaacc
gtcaaagtgctgaaccttactgacaacacgtacttaaaactgaacgatgaagtgatcatg
aacaggcggtacacctacctgggctacgcagtgaccgctggccacttctctcacgcgtcc
accactgatgtggtaggaggtgccccacaggacaaaggcatcggcaaggtttatattttc
agagctgaccgaagatcaggcaccttaattaagatctttcaagcatcaggtaaaaagatg
ggctcttacttcggctcctccttgtgcgcagttgacctgaatggggacggcctctctgac
ctgctggtgggggcccccatgttttctgagatcagggacgagggacaggtcactgtctac
atcaacagaggaaatggagccctcgaggagcagctggctctgaccggggatggcgcctac
aatgcgcactttggagaaagcattgccagcctagacgatctggatgacgatgggttccca
gatgtggccattggtgcacccaaggaggacgacttcgcaggggcggtctatatctatcat
ggtgatgccagtgggatagtcccgcagtactcaatgaaactgtctgggcggaagataaat
ccagtgctccggatgtttggtcagtccatatcgggaggcattgatatggatggaaatggc
tatcctgatgtcactgttggagccttcatgtccgacagcgtggttctcctcagagcaagg
cctgtcattacgatggatgtcgccatcttcctcccgggctccatcaacatcacggcgcct
cagtgtcacgacggacagcagcctgtgaactgcctgaacgtcaccacctgcttcagcttc
cgtggcaaacacgttccaggagagattggcctgaattatgttctgacggctgacgtggcc
aaaaaggagaagggccagctgcccagggtctactttgtgcttctgggagagaccgtgggt
caggtcacagagaagctgcagctgacttacatggaggagacgtgtcatcactacgtggcc
catgtgaagcggagggtgcaggacgtcatcagcccgatcgtgtttgaagcagcctacagc
ctcggtgagcatgtgactggagaggaggagagggaactgccgcctctgacaccagttctc
cgctggaaaaagggacaaaagattgcccaaaagaatcagactgtttttgaaaggaattgc
cattcagaggactgtgccgcggacctgcagcttcggggtaaactgctgctatctagtatg
gatgagaaaaccctgtatctagctttgggggctgtgaagaacatctccctaaacatctct
atctccaacctcggggatgatgcctatgacgccaacgtgtccttcaatgtttcccgggag
ctcttcttcatcaacatgtggcagaaggaggagatgggcatctcctgtgagctgctggaa
tcggacttcctcaaatgcagcgtgggatttcctttcatgagatcaaagtcaaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttctcagcttcatt
gttactgctcagagtggcaacatggagcgctctgaatccctgcatgacaacaccctcgtg
ctgatggtgccgctgatgcacgaggtggacacgtccatcaccggaatcatgtctccaacc
tcctttgtatatggtgagtccgtggatgcagccaacttcattcagctggatgacctggag
tgtcactttcagcccatcaatatcacccttcaggtctacaacactggcccgagcaccctt
ccagggtcatctgtcagcatctctttccctaatcgactctcatctggtggtgcagagata
tttcacgtccaggaaatggtggtgggccaagagaaaggaaactgctctttccagaaaaac
ccaactccctgcatcatccctcaagaacaagaaaatatcttccacacaatatttgctttt
ttcacaaagtctggcagaaaagtcttggactgtgaaaaaccaggaatttcttgcctaaca
gcacactgtaactttagtgctcttgctaaagaagaaagtcgtactatagacatttacatg
ctgctgaacacagaaatactgaaaaaggacagttcatctgtcatccagttcatgtcccgc
gccaaggtgaaggtggatcctgccctaagggtggtggaaatagctcatgggaacccagaa
gaggtgacggtggtcttcgaggccctgcacaatctggagccccgtggctacgtcgtgggc
tggatcatcgccatcagtttgttggtgggaatcctcatcttcctgctgctggctgtgttg
ctctggaagatgggcttctttcgccgaaggtacaaagaaattattgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673514
Entry
104673514         CDS       T03989                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05145  Toxoplasmosis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104673514 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104673514 (ITGA6)
   04514 Cell adhesion molecules
    104673514 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104673514 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104673514 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104673514 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673514 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104673514 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104673514 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104673514 (ITGA6)
   05414 Dilated cardiomyopathy
    104673514 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104673514 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104673514 (ITGA6)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104673514 (ITGA6)
  Exosomal proteins of breast milk
   104673514 (ITGA6)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104673514 (ITGA6)
CD molecules [BR:rro04090]
 Proteins
  104673514 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 104673514
NCBI-ProteinID: XP_010375889
UniProt: A0A2K6Q8E3
LinkDB
Position
14
AA seq 1091 aa
MAAAGQLCLLYLSAGLLPRLGSAFNLDAEEDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIYEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLRRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDTGKVFIYHGSANGINTK
PTQVLKGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKACFEYTAKPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQKEINFLNLKESHNSRK
KREITEKQIDDSRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILVRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggccgccgcggggcagctgtgcctgctctacctgtcggccgggctcctgccccggctc
ggctcagccttcaacttggacgctgaggaggacaacgtgatccggaaatatggggacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgcttgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaact
ggagggctgtacagctgtgacatcaccgcccgggggccatgcacacggatcgaatttgat
aacgatgctgaccccacatcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctatgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaggagagatatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacacgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
cctacacaggttctcaagggtaaatcaccttatttcggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatccaggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
gcctgttttgaatatactgctaaacccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatcggggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatacccaagaactaactctgaaaaggcagaaacagaaa
gtgtgcatggaggaaaccctctggctacaggataatatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagaaccaagctctcgtaggcgagttaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatactgatgtgcac
ttcttaaaagagggatgtggagatgacaatgtatgtaacagcaaccttaaactagaatac
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttgacatattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagcttgga
aatccttttaaaagaaattcaagtgttactttttatttggttttaagtacaactgaagtc
acctttgacactccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaattaacttaggt
aaacctcttaaaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaaggagataaacttcctgaacctcaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgatagcagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagtgtgaacgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcatctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattcttgtgcgagccttcattgat
gtgactgctgctgccgaaaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggattttgatgcttgctctgttagtgtttatactgtggaagtgtgga
ttcttcaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673715
Entry
104673715         CDS       T03989                                 

Gene name
ITGA7
Definition
(RefSeq) integrin alpha-7 isoform X1
  KO
K06583  integrin alpha 7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104673715 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104673715 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104673715 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104673715 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104673715 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104673715 (ITGA7)
   05414 Dilated cardiomyopathy
    104673715 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104673715 (ITGA7)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104673715 (ITGA7)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104673715 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF3488 LYRIC DUF2207
Other DBs
NCBI-GeneID: 104673715
NCBI-ProteinID: XP_010376156
UniProt: A0A2K6RKM6
LinkDB
Position
10
AA seq 1141 aa
MAGARSRDPWGASWICYLLGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGEKEQDPRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVI
LRKDSASRLVPEVMLPGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY
VYLNQGGHWAEISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVAKPSQVLEGEAVGIKSFGYSLSGSLDVDGNQYPDLLVGSLADTVVLFRARPVLH
VSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRL
RGQVPRVTFLSRSPDEPKHQASGTVWLKHQHDRVCGDAVFQLQDNVKDKLRAIVVTLSYS
LQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCA
RVSDTEFQPLPMDADGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVM
LPDSLHYSGVRALEPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETT
ELKVELLLATISEQELHPVSARARVFIELPLSIAGMATPQQLFFSGVVRGERAMQSERDV
GSKVKYEVTVSNQGQSLKTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGQQGLCS
PRPNILHLDVDSRDRKRRELEQPEQREPGERQEPSMSWWPVSSAEKKKNITLDCARGTAN
CVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDA
SIVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVP
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHSELGPDGHAGPGT
A
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggccggggctcggagccgcgacccttggggggcctcctggatttgctaccttcttggc
tccctgctcgtcgaactgctcttctcacgggctgtcgccttcaatctggacgtgatgggt
gccttgcgcaaggagggcgagccaggcagcctcttcggcttctctgtggccttgcaccgg
cagttgcagccccgaccccagagctggctgctggtgggtgctccccaggccctggctctt
cctgggcagcaggcgaatcgcactggaggcctcttcgcttgccccttgagcctggaggag
accgactgctacagagtggacatcgaccagggagctgatgtgcaaaaggaaagcaaggag
aaccagtggctgggagtcagtgttcggagccaggggcctgggggcaagattgttacctgt
gcacaccgatatgaggcaaggcagcgagtggaccagatcctggagacacgggatatgatt
ggtcgctgctttgtgctaagccaggacctggccatccgggatgagttggatggtggggaa
tggaagttctgtgaggggcgcccccaaggccatgaacaatttgggttctgccagcagggc
acagctgccgccttctcccctgatagccactacctcctctttggggccccaggaacctat
aattggaagggcacggccagggtggagctctgtgctcagggctcagcggacctggcacac
ctggacgacggtccctacgaggcggggggtgagaaggagcaggacccccgcctcatcccg
gtccctgccaacagctactttggcttctctattgactcggggaaaggtctggtgcgtgca
gaagagctgagctttgtggctggggccccccgtgccaaccataagggtgctgtggtcatc
ctgcgcaaggacagcgccagtcgcctggtgcctgaggttatgctgcctggggagcgcttg
acctccggcttcggctactcgctggctgtggctgacctcaacagtgacggctggccagac
ctgatagtgggtgccccctacttctttgagcgccaagaagagctggggggtgccgtgtat
gtgtacttgaaccaggggggtcactgggctgagatctcccctctccggctctgtggctcc
cctgactccatgttcgggatcagcctggctgtcctgggggacctcaaccaagatggcttt
ccagatattgcagtgggcgccccctttgatggtgatggtaaagtcttcatctaccatggg
agcagcctgggggttgttgccaaaccttcgcaggtgctggagggcgaggctgtgggcatc
aagagcttcggctactccctgtcaggcagcttggatgtggatgggaaccaataccctgac
ttgctggtgggctccctggctgacactgttgtgctcttcagggccagacccgtcctccat
gtctcccatgaggtctctattgctccacgaagcattgacctggagcagcccaactgtgct
ggcggccactcggtctgcgtggacctaagggtctgtttcagctacattgcagtccccagc
agctacagccctactgtggccctggactatgtgttagacgcggacacagaccggaggctc
cggggtcaggttccccgtgtgaccttcctgagccgtagcccagatgaacccaagcaccag
gcctcaggcactgtgtggctgaagcaccagcatgaccgagtctgtggagatgccgtgttc
cagctccaggataatgtcaaagacaagcttcgggccattgtagtgaccttgtcctacagt
ctccagacccctcggctccggcgacaggctcctggccaggggctgcctccagtggccccc
atcctcaatgcccaccagcccagcacccagcgggcagagatccacttcctgaagcaaggc
tgtggtgaagacaagatctgccagagcaatctgcagctggtccgcgcccgcttctgtgcc
cgggtcagcgacacggaattccagcctctgcccatggatgcggatggaacaacagccctg
tttgcactgagtgggcagccagtcattggcctggagctgatggtcaccaacctgccatcg
gacccagcccagccccaggctgatggggatgacgcccatgaagcccagctcctggtcatg
cttcctgactcactgcactactcaggagtccgggccctggagcctgcggagaagccactc
tgcctgtccaacgagaatgcctcccatgttgagtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctacctcatccttagcacctcagggatcagcattgagaccacg
gaactgaaggtagagctgctgttggccacgatcagtgagcaggagctgcatccagtctct
gcacgagcccgtgtcttcattgagctgccactgtccattgcagggatggccactccccag
caactcttcttctctggcgtggtgaggggcgagagagccatgcagtctgagcgggatgtg
ggcagcaaggtcaagtatgaggtcacggtttccaatcaaggccagtcgctcaaaaccctg
ggctctgccttcctcaacatcatgtggcctcatgagattgccaatgggaagtggttgctg
tacccaatgcgggtggagctggagggcgggcaggggcctgggcagcaagggctttgctct
cccaggcccaacatcctccacctggatgtggacagtagggataggaagcggcgggagctg
gagcagcctgagcagcgggagcctggtgagcggcaggagcccagcatgtcctggtggcca
gtgtcctctgctgagaagaagaaaaacatcactctggactgcgcccggggcacggccaac
tgtgtagtgttcagctgcccactctacagctttgaccgcgcggctgtgttgcatgtctgg
ggccgtctctggaacagcaccttcctggaggagtactcagctgtgaagtccctggaagtt
attgtccgggccaacatcacagtgaagtcctccataaagaacttgatgctccgagatgcc
tccatagtgatcccggtgatggtatacttggaccccatggctgtggtggcagaaggagtg
ccctggtgggtcatcctcctggctgtactggctgggctgctggtgctagcactgctggtg
ctgctcttgtggaagatgggattcttcaaacgggcgaagcaccccgaggccaccgtgccc
cagtaccatgcggtgaagattcctcgggaagaccgacagcagttcaaggaggagaagaca
ggcaccatcctgaggaacaactggggcagcccccggcgggagggcccggatgcacacccc
atcctggctgccgatgggcattccgagctgggccccgatgggcatgcggggccaggcact
gcctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680210
Entry
104680210         CDS       T03989                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1 isoform X1
  KO
K06480  integrin alpha 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104680210 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104680210 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104680210 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104680210 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104680210 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104680210 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104680210 (ITGA1)
   05414 Dilated cardiomyopathy
    104680210 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104680210 (ITGA1)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104680210 (ITGA1)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104680210 (ITGA1)
CD molecules [BR:rro04090]
 Proteins
  104680210 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 HisK_sensor LYRIC Integrin_alpha VWA_CoxE Cation_ATPase_N
Other DBs
NCBI-GeneID: 104680210
NCBI-ProteinID: XP_010384360
UniProt: A0A2K6P7U8
LinkDB
Position
3
AA seq 1179 aa
MAPRPRARPGVAVACCWLLTVVLHCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPTKQTCCSSRQHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRKGEMVT
FKILFQFNTSYLMENVTIYLNATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSDNANCRPHIFEDPFSIDSGKKMTTSTDHLKQGTILDCNPCKFATITCNLTPSDVS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggcccctcggccccgcgcccgcccaggggtcgctgtcgcctgctgctggctcctcact
gttgttctacactgctgcgtatcattcaatgttgatgtgaaaaattcaatgactttcagt
ggcccagtggaagatatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctcctttagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtgaatcattaccttgtgtaaagttggatctaccagttaat
acatcaattcccaatgtcacagaagtaaaagagaacatgacatttggatcaactttagtc
accaacccaaatggaggatttttggcatgtgggcccttatatgcctatagatgtggacat
ttgcattacacaactggaatctgttctgacgtcagccccacatttcaagtcgtgaattcc
attgcccctgtaagagaatgcagcactcaactggacatagtcatagtgttagatggttcc
aacagtatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtatggagaaaacgtgacccat
gagttcaacctcaataagtattcttccaccgaagaggtacttgttgcagcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcattcacggaagcccggggtgcccgaagaggagttaaaaaagtcatggttattgtgacg
gatggagagtcccatgacaatcatcgactgaagaaggtcattcaagactgtgaagatgaa
aacattcaacggttttccatagctattcttggcagctataaccgaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagcgaacccactgaaaaacatttcttc
aatgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gccctggaagctacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctagtcaaatcatcatccctcgaaacacaacc
tttaatgttgagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacactgta
aactctgctactgcttcttctggagatgtgctctatattgctggacagcctcggtacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagaca
ctcagtggagaacagattggttcctactttggcagtattttaacaacaattgacattgac
aaggattctaatactgacattcttctagtcggagcccctatgtacatgggaacagagaaa
gaggagcaaggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctactaagcagacgtgctgttcatctcggcagcacaattcatgcacaaaa
gaaaacaaaaatgagccttgcggggctcgttttggaactgctattgctgctgtaaaagac
ctcaatcttgatggatttaatgacatcgtgataggagctccgctggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagactataaggaaagagtatgcacaacgt
attccatcaggtggggatggtgagacactgaaattttttggccagtctatccacggagaa
atggatttaaatggtgacggtctgacagatgtgactattgggggccttggtggtgctgcc
ctcttctggtcccgagatgtggccgtagttaaagtgaccatgaattttgagccaaataaa
gtgaatattcaaaagaaaaactgccatatggagggaaaggaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaaatctaaagaagacacgatttatgaagctgatttg
cagtaccgtgtcaccctagattcactaaggcaaatatcacgaagttttttctctggaact
caagagagaaaagttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaagcatgactttcaggactctgtgagaataacgttggactttaat
cttaccgatccagaaaatgggcctgttcttgatgattctctaccgaactcagtacatgaa
tacattccttttgccaaagattgtggaaacaaggaaaaatgtatctcggacctcagcctg
catgtcgccaccacagaaaaggacctgctaattgtccggtcccagaatgataagttcaat
gttagcctcacagtcaaaaatacaaaggacagtgcctacaacaccaggacaatagtgcat
tattctccaaatctagttttttcaggaattgaggctatccaaaaagacagctgtgaatcc
aatcataatatcacatgtaaagttggatatcccttcctgagaaaaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctatctcatggaaaatgtgaccatttattta
aatgcaacaagcgacagcgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctatcccggtaaaatatgaagttggactacagttttacagctctgcaagtgaataccac
atttcaattgctgccaatgagacagtccctgaagttattaattctacggaggacattgga
aatgaaattaatatcttctacctgattagaaaaagtggatcttttccaatgccagaactt
aagctgtcaatttcattccccaatatgacatcgaatggttatcctgtgctgtacccaact
ggattgtcatcttctgataatgcaaactgcagaccccatatctttgaggatcctttcagt
atagactctggaaagaaaatgactacatcaactgaccatctcaaacaaggcacaattctg
gactgcaatccatgtaaatttgctaccatcacatgtaatctcactccttctgacgtgagc
caagtgaatgtttcacttatcttgtggaaaccaacttttataaaatcatatttttccagc
ttaaatcttactataaggggagaacttcggagtgaaaatacatcactggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatatccaaagatgggctaccaggcagagtg
ccattatgggtcatcctgctgagtgcttttgctggattattgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccactgaaaaagaaaatggagaaatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680261
Entry
104680261         CDS       T03989                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104680261 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104680261 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104680261 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104680261 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104680261 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680261 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104680261 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104680261 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104680261 (ITGA3)
   05414 Dilated cardiomyopathy
    104680261 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104680261 (ITGA3)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104680261 (ITGA3)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104680261 (ITGA3)
CD molecules [BR:rro04090]
 Proteins
  104680261 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 104680261
NCBI-ProteinID: XP_030779605
LinkDB
Position
19
AA seq 1049 aa
MGPGPSRAPRAPRLMLCALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQT
ERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIEDM
WLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTYHN
EMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDP
EDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQ
VGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPAHPSLLLH
GPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLPRQPQQVIHGEKL
GLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVLDP
ALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGF
FSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDGYPILNQAQA
LENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRT
SEHTGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEV
IGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVMGE
SGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITIHGNG
SWPCRPPGDLVNPLNLTLSDPGDRLSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVL
TCATGRARCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSI
PTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRA
RTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctttgcgccttgatg
gtggcggccggcggctgtgtcgtctccgccttcaacctggatacccgattcctggtagtg
aaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcggcagaca
gagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtgcccgat
ggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaaggacgac
tgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgaggacatg
tggcttggagtgactgtggccagccagggccctgcaggcagagtcctggtctgtgcccac
cgctacacccaggtgctgtggtcggggtcagaagaccagcggcgcatggtgggcaagtgc
tatgtgcgaggcaatgacctagagctggaccccagtgatgactggcagacctaccacaac
gagatgtgcaacagcaacactgactacctggagacaggcatgtgccagctgggcaccagc
ggtggcttcacccagaacactgtgtacttcggtgcccccggtgcctacaactggaaagga
aacagctacatgattcagcgtaaggagtgggacttatctgagtatagttacaaggaccca
gaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatcctgcac
cccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggtgcggtcttc
ttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggctcgcag
gtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatgggtggcag
gacctcctggtgggcgccccctactactttgagaggaaagaggaggtagggggtgctgtc
tatgtcttcatgaaccaggcaggaacctccttccctgctcacccctcactccttcttcat
ggccccagtggctccgccttcggcttatccgtggccagcattggtgacatcaaccaggat
ggatttcaggatattgctgtgggagctccatttgaaggcttgggcaaagtgtacatctat
cacagtagctctaaggggctccccagacagccccagcaggtaatccacggagagaagctg
ggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtggatgag
aacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctgcgggcc
cggcccgtcatcaacatcgtccacaagaccttggtggccaggcccgctgtgctggaccct
gcactttgcacggccacctcctgtgtgcaagtggagctgtgctttgcttacaaccagagt
gccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggccgacagg
gaccgccgcccgccccggctccgctttgctggcagtgagtctgctgtcttccacggcttc
ttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaacctccgt
gacaaactccggcccatcatcatctccatgaactactctttacctttgcggatgcccgat
cgcccccggctggggctgaggtccctggacggctacccgatccttaaccaggcacaggct
ctggagaaccacactgaggtccagttccagaaggagtgcggccccgacaacaagtgtgag
agcaacttgcagatgcgggcagccttcgtgtctgagcagcagcagaagctgagcaggctc
cagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacccggacc
tcggagcacaccggagaggacgcccacgaggcactgctcaccctggtggtgcctcccgcc
ctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatcttttgc
gagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgcctttgaggtc
atcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacgtcaagt
caccaggacaacctctggcccatgaccctcactctgctggtggactatacactccagacc
tcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatgggcgag
tctggcatgaaaactgtggaggatgtcggaagccccctcaagtatgaattccaggtgggc
ccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggaatggccctat
gaagtcagcaatggcaagtggctgctgtatcccacggagatcaccatccatggcaatggg
tcctggccctgccgaccacctggagaccttgtcaaccctctcaacctcactctttctgac
cctggggacaggctgtcatccccacagcgcaggcggcgacagctggatccaggaggaggc
cagggtcccccacctgtcactctggctgctgccaaaaaagccaagtctgagactgtgctg
acctgtgccacagggcgtgcccgctgtgtgtggctggagtgccccatccctgatgccccc
attgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgaggattac
agagactttgaccgagtccgggtaaatggctgggctaccctgttcctccgaaccagtatc
cccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcggagctg
gtggaggagctgccggctgagatcgagctgtggctggtgctggtggccgtgggtgcgggg
ctgctgcttctggggctgatcattctcctgctgtggaagtgcggcttcttcaagcgagcc
cgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccagccgtca
gagacagagaggctgaccgacgactactga

DBGET integrated database retrieval system