KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654717
Entry
104654717         CDS       T03989                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04611  Platelet activation
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104654717 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    104654717 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104654717 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104654717 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104654717 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104654717 (ITGA2B)
   04611 Platelet activation
    104654717 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654717 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104654717 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104654717 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    104654717 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104654717 (ITGA2B)
   05414 Dilated cardiomyopathy
    104654717 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104654717 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104654717 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104654717 (ITGA2B)
   04515 Cell adhesion molecules [BR:rro04515]
    104654717 (ITGA2B)
   04090 CD molecules [BR:rro04090]
    104654717 (ITGA2B)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104654717 (ITGA2B)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104654717 (ITGA2B)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104654717 (ITGA2B)
CD molecules [BR:rro04090]
 Proteins
  104654717 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 104654717
NCBI-ProteinID: XP_010352282
UniProt: A0A2K6R6Z1
LinkDB
Position
19
AA seq 1090 aa
MSPWAIALCSAHCSASYLGFQFDKKRLPVEESEGKKEELAHSCLGGCGRRKMARALCPLQ
ALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDSHGRVAIVVG
APRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVV
SWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVEN
NFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRPGILLWHVSS
QSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILGSYYQRLH
RLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPH
TLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQVLVFLGQSEG
LSSRPSQVLESPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASV
QLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQLDRQKPRQG
RRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSLNVSLPPTEA
GMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLKLQMDTA
NEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNTQ
IGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPAS
LVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQHSDLLYIVNI
QPQGGLQCFPQPPVNPRKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLV
SCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAWFNVSSLPYA
VPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
PLEEDDEEGE
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgagtccatgggctatagccctttgctctgcccattgctcagcaagttacttggggttc
cagtttgataagaaaagacttcctgtggaggaatctgaagggaagaaggaggagctggcc
cattcctgcctgggaggttgtggaagaaggaagatggccagagctttgtgtccactgcaa
gccctctggcttctggagtgggtgctgctgctcttgggaccttgtgctgcccctccagcc
tgggccttgaatctggacccagtgcatctcaccttctatgcaggccccaatggcagccac
tttgggttttcactggacttccacaaggacagccatgggagagtggccatcgtggtgggc
gccccacggaccctgggtcccagccaggaggagacgggcggcgtgttcctgtgcccctgg
agagccgagggcggccagtgcccctcgctactctttgacctccgtgatgagacccgaaat
gtaggctcccagactttacaaaccttcaaggcccgccaaggactaggggcgtcggtcgtc
agctggagcgacgtcattgtggcctgcgccccctggcagcactggaacgtcctagaaaag
accgaggaggctgagaagacgcccgtaggcagctgctttttggctcagccagagagcggc
cgccgcgccgagtactccccctgtcgcgggaacaccctgagccgcatttacgtggaaaat
aattttagctgggacaagcgttactgtgaagcgggcttcagctccgtggtcactcaggcg
ggggagctggtgcttggggctcctggaggctattatttcttaggtctcctggcccaggct
ccaattgcggatattttctcgagttaccgcccaggcatccttttgtggcacgtgtcctcc
cagagcctctccttcgactccagcaacccagagtatttcgacggctactgggggtactcg
gtggctgtgggcgagttcgacggggatctcaacactacagagtatgtcgtcggtgccccc
acttggagctggacgctgggagcggtggaaattttgggctcctactaccagaggctgcac
cggctacacggagagcagatggcttcgtattttgggcattcagtggctgtcactgacgtc
aacggggatgggaggcatgacctgctggtgggcgctccactgtatatggaaagccgggca
gaccgaaaactggccgaagtggggcgtgtgtatttgttcctgcagccgcgaggcccccac
acgctgggtgcccccagcctcctgctgactggcacacagctctatgggcgattcggctct
gccatcgcacccctgggcgacctcgaccaggatggctacaatgacattgcagtggctgcc
ccctacgggggtcccagtggccggggccaagtgctggtgttcctgggtcagagtgagggg
ctgagttcacgtccctcccaggtcctggaaagccccttccccacaggctctgcctttggc
ttctcccttcgaggtgccgtagacatcgatgacaacggatacccagacctgattgtggga
gcttacggggccaaccaggtggctgtgtacagagctcagccagtggtgaaggcctctgtc
cagctactggtacaagattcactgaatcctgctgtgaagagctgtgtcctaccccagacc
aagacacccgtgagctgcttcaaaatccagatgtgtgttggagccactgggcacaacatt
cctcagaagctgtccctaaatgccgagctgcagttggaccggcagaagccccgccagggc
cggcgggtgctgctgctgggctctcaacaggcaggcaccaccctgaacctggatctgggc
ggaaagcacagccccatctgccacaccaccatggccttccttcgagatgaggccgaattc
cgggacaagctgagccccattgtgctcagcctcaatgtgtccctgccgcccacggaggct
ggaatggcccctgctgtcgtgctgcatggagacacccatgtgcaggagcagacacgaatc
gtcctggactgcggggaagatgacgtgtgtgtgccccagcttcagctcactgccagcgtg
acaggctccccgctcctagttggggcagataatgtcctgaagctgcagatggacacagcc
aacgagggcgagggggcctatgaagcagagctggccgtgcatctgccccagggggcccac
tacatgcgggccctaagcaacgtcgagggctttgagagactcatctgtaaccagaagaag
gagaatgagaccagggtggtgctgtgtgagctgggcaatcccatgaagaagaacacccag
ataggaatcgcgatgttggtgagcgtggggaatctggaagaggctggggagtctgtgtcc
ttccagctgcagatccggagcaagaacagccagaatccaaacagcaagattgtgctgctg
gatgtgccagtccgggcagaggcccaagtggagctgcgagggaactcctttccagcctcc
ctggtggtggctgcagaagaaggtgacagggagcagaacagcttggacagccggggaccc
aaagtggagcacacctatgagctccacaacaatggccctgggactgtgaatggccttcac
ctcagcatccacctcccggggcagtcccagcactccgacctgctctatatcgtgaatata
cagccccaggggggccttcagtgcttcccacagcctcctgtcaacccccgcaaggtggac
tgggggctgcccacccccagcccctcccccattcacccagcccatcacaagcgggatcgc
agacagatcttcctgccagagcccgagcagccctcgaggcttcaggatccagttctcgta
agctgcgactcggcgccctgtactgtggtgcagtgtgacctgcaggagatggcgcgcggg
cagcgggccatggtcacggtgctggctttcctgtggctgcccagtctccaccagaggcca
ctggatcagtttgtgctgcagtcacaggcatggttcaacgtgtcctccctcccctacgct
gtgcccccgctcagcctgccacgaggggaagctcaggtgcggacacagctgcttcgggcc
ttggaggagagggccattccaatctggtgggtgctggtgggtgtgctgggcggcctgctg
ctgctcaccatcctggtcctggccatgtggaaggtgggcttcttcaagcggaaccggcca
cccctggaagaagatgatgaagagggggagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104667754
Entry
104667754         CDS       T03989                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V isoform X2
  KO
K06487  integrin alpha V
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04810  Regulation of actin cytoskeleton
rro04919  Thyroid hormone signaling pathway
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104667754 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104667754 (ITGAV)
   04514 Cell adhesion molecules
    104667754 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104667754 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104667754 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104667754 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104667754 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104667754 (ITGAV)
   05205 Proteoglycans in cancer
    104667754 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104667754 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104667754 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    104667754 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104667754 (ITGAV)
   05414 Dilated cardiomyopathy
    104667754 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104667754 (ITGAV)
   05165 Human papillomavirus infection
    104667754 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104667754 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104667754 (ITGAV)
   04515 Cell adhesion molecules [BR:rro04515]
    104667754 (ITGAV)
   04090 CD molecules [BR:rro04090]
    104667754 (ITGAV)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    104667754 (ITGAV)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104667754 (ITGAV)
  Exosomal proteins of epithelial cells
   104667754 (ITGAV)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104667754 (ITGAV)
CD molecules [BR:rro04090]
 Proteins
  104667754 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 104667754
NCBI-ProteinID: XP_010368605
UniProt: A0A2K6NBD3
LinkDB
Position
14
AA seq 1048 aa
MASPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTELKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSIYNFTGD
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFFYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYWLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVFVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctggacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacacgacccagcctgggatt
gtggaaggagggcaagtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggacgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaagataaaattttggcctgtgcccca
ttgtaccattggaggactgagttgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgcagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatatgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagttatttgggttactctgtggctgttggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccatatacaattttactggcgat
cagatggctgcatatttcgggttttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccag
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacaacaaag
ctgaatgggtttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaatcgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgctttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccagaaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttttctacagcaggtccccaagtcactccaagaacatgactatttcaagaggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattaccatttttatggaatattggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttttgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctatgaagctgagctcattgtttccattccactgcag
gctgatttcatcggggttgtccgaaacagtgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgaccttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatatctttcttcccattccaaactgggagcacaaggagaaccccgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccgagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataacaataacactttgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatttcatctttgcaaacaactgaaaagaatgacacagttgctgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagtcgctcagtgcttgaagattgtctgccaagttggaagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacctttatgaat
aaagaaaatcagaatcattcctattctctgaagtcatctgcttcatttaatgtcatagag
tttccttataaaaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcacccatgcctgtgcctgtgtgggtgatcattttagca
gttcttgcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaggaacaagaaagggaacaacttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672477
Entry
104672477         CDS       T03989                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04145  Phagosome
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04611  Platelet activation
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104672477 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104672477 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104672477 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104672477 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104672477 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104672477 (ITGA2)
   04611 Platelet activation
    104672477 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672477 (ITGA2)
   05205 Proteoglycans in cancer
    104672477 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104672477 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104672477 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104672477 (ITGA2)
   05414 Dilated cardiomyopathy
    104672477 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104672477 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104672477 (ITGA2)
   04515 Cell adhesion molecules [BR:rro04515]
    104672477 (ITGA2)
   04090 CD molecules [BR:rro04090]
    104672477 (ITGA2)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104672477 (ITGA2)
  Exosomal proteins of bladder cancer cells
   104672477 (ITGA2)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104672477 (ITGA2)
CD molecules [BR:rro04090]
 Proteins
  104672477 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 104672477
NCBI-ProteinID: XP_030783442
LinkDB
Position
3
AA seq 1180 aa
MRPGRTGPSPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNVTVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILSQH
QFLEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTVRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADIAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETTKV
FSIPFHKDCGEDGLCIADLVLDVQQIPAAQEQPFTVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDIGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSVSFKSENFRHTKELNCRTASCSNVTCWLKDLHMKGEYFVNVTTRIWN
GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPIGVIIGSIIA
GILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgcggccaggacggacagggccctcgccactgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcatacaatgttggtctccctgaagcaaaaatattt
tctggtccttcaagtgaacagtttggctatgcagtgcagcagttcataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataagtgtcccgttgacctatccactgccacatgtgaaaaactaaatttgcagacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgaccctcaca
aggaacatgggaactggagggtttctcacatgtggtcctctgtgggcacagcagtgtggg
aatcagtattacacaacaggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcagctcagccctgcccttccctcatagatgttgtagttgtatgtgat
gaatcaaacagtatttatccttgggatgcagtgaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacatttggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtggacgacgaagtgctaccaaagtaatggtagtt
gtaactgatggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaatgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gttggattcagtgcagattactctcctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaggcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcacccactttgttgctggtgctcctcgggcaaat
tacaccggccagatagtgctgtacagtgtgaatgagaatggcaatgtcacagttattcag
gctcaccgaggtgaccagataggctcctatttcggtagcgtgctgtgttcagttgatgtg
gataaagacaccattacagatgtgctcttggtaggtgcaccaatgtacatgaatgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaaaagggcattttgagtcagcac
caatttcttgaaggccccgagggcattgaaaatgctcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaacgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttataatggtcatcagggcactgtccgcacgaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtccattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatatagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaataagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaataatcaagtggccattgtatataacatc
acccttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccctgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactaccaaggtc
ttcagtattcctttccacaaagactgtggtgaggatggactttgcattgctgatctagtt
ctagatgtccaacaaataccagctgctcaagaacaaccctttactgtcagcaaccaaaac
aaaaggttaacattttcagtaacactgaaaaacaaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgtgatgtaggctac
cctgctttaaagagagaacaacaggtgacctttactattaacttcgacttcaatcttcaa
aaccttcagaatcaggcatctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaatacctctcctgtacgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatattggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcaatataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttctgtatctttcaaaagtgaaaat
ttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgctgg
ttgaaagaccttcacatgaaaggagaatactttgttaatgtgactacaagaatttggaac
gggacttttgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatcaac
acctataaccctgagatatacgtgatcgaagataacactgttacgattcccctgatgata
atgaaacctgatgagaaagccgaagtaccaataggagttataataggaagtataatcgct
ggaatccttttgctgttagctctggttgcaattttatggaagcttggctttttcaaaaga
aaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagaactcaatagc
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673514
Entry
104673514         CDS       T03989                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04514  Cell adhesion molecules
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05145  Toxoplasmosis
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104673514 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104673514 (ITGA6)
   04514 Cell adhesion molecules
    104673514 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104673514 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104673514 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104673514 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673514 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104673514 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104673514 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104673514 (ITGA6)
   05414 Dilated cardiomyopathy
    104673514 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104673514 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104673514 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104673514 (ITGA6)
   04515 Cell adhesion molecules [BR:rro04515]
    104673514 (ITGA6)
   04090 CD molecules [BR:rro04090]
    104673514 (ITGA6)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104673514 (ITGA6)
  Exosomal proteins of breast milk
   104673514 (ITGA6)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104673514 (ITGA6)
CD molecules [BR:rro04090]
 Proteins
  104673514 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 104673514
NCBI-ProteinID: XP_010375889
UniProt: A0A2K6Q8E3
LinkDB
Position
14
AA seq 1091 aa
MAAAGQLCLLYLSAGLLPRLGSAFNLDAEEDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIYEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLRRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDTGKVFIYHGSANGINTK
PTQVLKGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKACFEYTAKPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQKEINFLNLKESHNSRK
KREITEKQIDDSRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILVRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggccgccgcggggcagctgtgcctgctctacctgtcggccgggctcctgccccggctc
ggctcagccttcaacttggacgctgaggaggacaacgtgatccggaaatatggggacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgcttgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaact
ggagggctgtacagctgtgacatcaccgcccgggggccatgcacacggatcgaatttgat
aacgatgctgaccccacatcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctatgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaggagagatatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacacgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
cctacacaggttctcaagggtaaatcaccttatttcggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatccaggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
gcctgttttgaatatactgctaaacccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatcggggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatacccaagaactaactctgaaaaggcagaaacagaaa
gtgtgcatggaggaaaccctctggctacaggataatatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagaaccaagctctcgtaggcgagttaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatactgatgtgcac
ttcttaaaagagggatgtggagatgacaatgtatgtaacagcaaccttaaactagaatac
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttgacatattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagcttgga
aatccttttaaaagaaattcaagtgttactttttatttggttttaagtacaactgaagtc
acctttgacactccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaattaacttaggt
aaacctcttaaaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaaggagataaacttcctgaacctcaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgatagcagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagtgtgaacgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcatctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattcttgtgcgagccttcattgat
gtgactgctgctgccgaaaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggattttgatgcttgctctgttagtgtttatactgtggaagtgtgga
ttcttcaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680261
Entry
104680261         CDS       T03989                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04512  ECM-receptor interaction
rro04640  Hematopoietic cell lineage
rro04810  Regulation of actin cytoskeleton
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104680261 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    104680261 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104680261 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104680261 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104680261 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680261 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104680261 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104680261 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104680261 (ITGA3)
   05414 Dilated cardiomyopathy
    104680261 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104680261 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104680261 (ITGA3)
   04515 Cell adhesion molecules [BR:rro04515]
    104680261 (ITGA3)
   04090 CD molecules [BR:rro04090]
    104680261 (ITGA3)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104680261 (ITGA3)
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104680261 (ITGA3)
CD molecules [BR:rro04090]
 Proteins
  104680261 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 104680261
NCBI-ProteinID: XP_030779605
LinkDB
Position
19
AA seq 1049 aa
MGPGPSRAPRAPRLMLCALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQT
ERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIEDM
WLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTYHN
EMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDP
EDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQ
VGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPAHPSLLLH
GPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLPRQPQQVIHGEKL
GLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVLDP
ALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGF
FSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDGYPILNQAQA
LENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRT
SEHTGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEV
IGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVMGE
SGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITIHGNG
SWPCRPPGDLVNPLNLTLSDPGDRLSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVL
TCATGRARCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSI
PTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRA
RTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctttgcgccttgatg
gtggcggccggcggctgtgtcgtctccgccttcaacctggatacccgattcctggtagtg
aaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcggcagaca
gagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtgcccgat
ggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaaggacgac
tgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgaggacatg
tggcttggagtgactgtggccagccagggccctgcaggcagagtcctggtctgtgcccac
cgctacacccaggtgctgtggtcggggtcagaagaccagcggcgcatggtgggcaagtgc
tatgtgcgaggcaatgacctagagctggaccccagtgatgactggcagacctaccacaac
gagatgtgcaacagcaacactgactacctggagacaggcatgtgccagctgggcaccagc
ggtggcttcacccagaacactgtgtacttcggtgcccccggtgcctacaactggaaagga
aacagctacatgattcagcgtaaggagtgggacttatctgagtatagttacaaggaccca
gaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatcctgcac
cccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggtgcggtcttc
ttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggctcgcag
gtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatgggtggcag
gacctcctggtgggcgccccctactactttgagaggaaagaggaggtagggggtgctgtc
tatgtcttcatgaaccaggcaggaacctccttccctgctcacccctcactccttcttcat
ggccccagtggctccgccttcggcttatccgtggccagcattggtgacatcaaccaggat
ggatttcaggatattgctgtgggagctccatttgaaggcttgggcaaagtgtacatctat
cacagtagctctaaggggctccccagacagccccagcaggtaatccacggagagaagctg
ggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtggatgag
aacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctgcgggcc
cggcccgtcatcaacatcgtccacaagaccttggtggccaggcccgctgtgctggaccct
gcactttgcacggccacctcctgtgtgcaagtggagctgtgctttgcttacaaccagagt
gccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggccgacagg
gaccgccgcccgccccggctccgctttgctggcagtgagtctgctgtcttccacggcttc
ttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaacctccgt
gacaaactccggcccatcatcatctccatgaactactctttacctttgcggatgcccgat
cgcccccggctggggctgaggtccctggacggctacccgatccttaaccaggcacaggct
ctggagaaccacactgaggtccagttccagaaggagtgcggccccgacaacaagtgtgag
agcaacttgcagatgcgggcagccttcgtgtctgagcagcagcagaagctgagcaggctc
cagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacccggacc
tcggagcacaccggagaggacgcccacgaggcactgctcaccctggtggtgcctcccgcc
ctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatcttttgc
gagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgcctttgaggtc
atcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacgtcaagt
caccaggacaacctctggcccatgaccctcactctgctggtggactatacactccagacc
tcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatgggcgag
tctggcatgaaaactgtggaggatgtcggaagccccctcaagtatgaattccaggtgggc
ccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggaatggccctat
gaagtcagcaatggcaagtggctgctgtatcccacggagatcaccatccatggcaatggg
tcctggccctgccgaccacctggagaccttgtcaaccctctcaacctcactctttctgac
cctggggacaggctgtcatccccacagcgcaggcggcgacagctggatccaggaggaggc
cagggtcccccacctgtcactctggctgctgccaaaaaagccaagtctgagactgtgctg
acctgtgccacagggcgtgcccgctgtgtgtggctggagtgccccatccctgatgccccc
attgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgaggattac
agagactttgaccgagtccgggtaaatggctgggctaccctgttcctccgaaccagtatc
cccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcggagctg
gtggaggagctgccggctgagatcgagctgtggctggtgctggtggccgtgggtgcgggg
ctgctgcttctggggctgatcattctcctgctgtggaagtgcggcttcttcaagcgagcc
cgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccagccgtca
gagacagagaggctgaccgacgactactga

DBGET integrated database retrieval system