KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654721
Entry
104654721         CDS       T03989                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104654721 (FZD2)
   04390 Hippo signaling pathway
    104654721 (FZD2)
   04150 mTOR signaling pathway
    104654721 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104654721 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104654721 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654721 (FZD2)
   05205 Proteoglycans in cancer
    104654721 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104654721 (FZD2)
   05226 Gastric cancer
    104654721 (FZD2)
   05217 Basal cell carcinoma
    104654721 (FZD2)
   05224 Breast cancer
    104654721 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104654721 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    104654721 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104654721 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104654721 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104654721 (FZD2)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104654721 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 104654721
NCBI-ProteinID: XP_010352284
LinkDB
Position
19
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgctgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctggaggtgcaccagttctatccgctggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgttccatgtacgcacccgtgtgc
accgtgctggaacaggccataccgccgtgccgctctatctgcgagcgcgcgcgccagggc
tgcgaagcgctcatgaacaagtttggttttcagtggccggagcgcctgcgctgcgagcac
ttcccgcgccacggcgccgagcagatctgcgtgggccagaaccactccgaggacggagcg
cccgcgctgctcaccaccgcgccgccgccgggactgcagccgggagccgggggcaccccg
ggcggcccgggcggcggcggcgctcccccgcgctacgccacgctggagcaccccttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgat
tgtgctgcgccctgcgaacccgcacggcccgatggttccatgttcttctcacaggaggag
acgcgtttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcttccaccttc
ttcactgtcaccacgtacttggtagacatgcagcgcttccgctacccagagcggcctatc
atttttctgtcgggctgctacaccatggtgtcggtggcctacatcgcaggcttcgtgctc
caggagcgcgtggtgtgcaatgagcgcttctccgaggacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggctgtgccg
gccgtcaagaccatcactatcctggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcggggcttcgtgctagcgccgctc
ttcgtgtacctgttcatcggcacgtccttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgagaagctggagcggctcatggtg
cgcatcggcgtcttctctgtgctctacacggtgcccgccaccatcgtcatcgcctgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccttgcccggcgcactacacgccgcgcatgtcgcccgacttcactgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagccggcac
ggcgagaccaccgtgtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655138
Entry
104655138         CDS       T03989                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6 isoform X1
  KO
K02376  frizzled 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104655138 (FZD6)
   04390 Hippo signaling pathway
    104655138 (FZD6)
   04150 mTOR signaling pathway
    104655138 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104655138 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104655138 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655138 (FZD6)
   05205 Proteoglycans in cancer
    104655138 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104655138 (FZD6)
   05226 Gastric cancer
    104655138 (FZD6)
   05217 Basal cell carcinoma
    104655138 (FZD6)
   05224 Breast cancer
    104655138 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104655138 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    104655138 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104655138 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104655138 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104655138 (FZD6)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104655138 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC Integrin_alpha
Other DBs
NCBI-GeneID: 104655138
NCBI-ProteinID: XP_010352827
UniProt: A0A2K6PSF1
LinkDB
Position
9
AA seq 706 aa
METFTFLLTCIFLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEH
FLPLANLECSPNIETFLCKAFVPTCTEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFQSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTILFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPEASMREV
RADGASTPRLREQDCGEPASPAASSSRLSGEQVDRKGQAGSVSEGARSEGRISPKSDITD
TGLAQSNSLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggaaacgtttacatttttgttgacgtgtatttttctacccctcataagagggcacagt
ctcttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccagagtattgccgctgtggaaatggagcat
tttcttcctcttgcaaatctggaatgttcaccaaacattgaaactttcctctgcaaggca
tttgtaccaacctgcacagagcaaattcatgtggttccaccttgtcgtaaactttgtgag
aaagtatattctgattgcaaaaaattaattgacacttttgggatccgatggcctgaggag
cttgaatgtgacagattacaatactgtgatgagactgttcctgtaacttttgatccacac
acagaatttcttggtcctcagaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaagggtataagtttctgggaattgaccaa
tgtgcgcctccatgccccaacatgtattttcaaagcgatgagctagagtttgcaaaaagt
tttattggaatagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttagaagattcagatacccagagagaccgattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggatttttgctaggcgatagcacagcctgc
aataaggcagatgagaagctagaacttggtgacactgttgtcctagggtctcaaaataag
gcttgcaccattttgttcatgcttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatc
gaacaaaaagcagtgtggtttcatgctgttgcatggggaacaccaggtttcctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggagtttgctttgttggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctctctcttcttttagctggcattatttccttaaatcatgttcgacaagtcata
caacatgatggccggaaccaagaaaaactaaagaaatttatgattcgaattggagtcttc
agcggcttgtatcttgtgccattagtgacacttctcggatgttacgtctatgagcaagtg
aacaggattacctgggagataacttgggtctctgatcattgtcgtcagtaccatatccca
tgtccttatcaggcaaaagcaaaagctcgaccagaattggctttatttatgataaaatac
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggaatcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactataaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaattactagccatgattac
ctaggacaagaaactttgacagaaatccaaacctcaccagaagcatcaatgagagaggtg
agagcggacggagctagcacccccaggttaagagaacaggactgtggtgaacctgcctcg
ccagcagcatccagctccagactctctggggaacaggtcgacaggaagggccaggcaggc
agtgtatctgaaggtgcacggagtgaaggaaggattagtccaaagagtgatattactgac
actggcctggcacagagcaacagtttgcaggtccccagttcttcagaaccaagcagcctc
aaaggttccacatctctacttgttcacccggtttcaggagtaagaaaagagcagggaggt
ggttgtcattcagatacttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655247
Entry
104655247         CDS       T03989                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104655247 (FZD1)
   04390 Hippo signaling pathway
    104655247 (FZD1)
   04150 mTOR signaling pathway
    104655247 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104655247 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104655247 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655247 (FZD1)
   05205 Proteoglycans in cancer
    104655247 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104655247 (FZD1)
   05226 Gastric cancer
    104655247 (FZD1)
   05217 Basal cell carcinoma
    104655247 (FZD1)
   05224 Breast cancer
    104655247 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104655247 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    104655247 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104655247 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104655247 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104655247 (FZD1)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104655247 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 104655247
NCBI-ProteinID: XP_010352954
LinkDB
Position
6
AA seq 646 aa
MAEEEVPKKSRAAGGGVSWELCAGALSARLAEEGSGDASGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAVGQGPGQGPGPGQQPPPPQQQQSGQQYNGERGISIPDHGYCQPISI
PLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLE
QALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPS
LLPEFWTSNPQHGGGGHRGGFPGGASASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCE
PTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGC
YTAVAVAYIAGFLLEDRVVCNDKFTEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWV
ILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGL
NNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFS
VLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFT
VFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggtgcctaagaagtcccgggccgccggcggcggcgtgagctgggaa
ctttgtgccggagcgctctcggcccggctggcggaggaggggagcggggacgccagtggc
cgccgccgccccccggttgacccccggcggttggcgcgccagctgctgctgctgctttgg
ctgctggaggctccgctgctgctgggggtccgggcgcaggcggtgggccaggggccaggc
caggggcccgggccggggcagcagccgccgccgcctcagcagcaacagagtgggcagcag
tacaacggtgagcggggcatctccatcccggaccacggctattgccagcccatctccatc
ccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctcctgggccacacg
aaccaggaggacgcgggcctcgaggtgcaccagttctacccgctagtgaaagtgcagtgt
tccgctgagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgctagag
caagcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgcgaggcgctc
atgaacaagttcggcttccagtggccagacacgctcaagtgcgagaagttcccggtgcac
ggcgccggcgagctgtgcgtgggccagaacacgtccgacaagggcaccccgacgccctcg
ctgcttccagagttttggacaagcaaccctcagcacggcggcggagggcaccgtggaggc
ttcccggggggcgccagcgcgtcggagcgaggcaagttctcctgcccgcgcgccctcaag
gtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgcaccctgtgag
ccgaccaaggtgtacgggctcatgtacttcggacccgaggagctgcgcttctcgcgcacc
tggattggcatctggtcagtgctgtgctgcgcctccacgctcttcacagtgcttacgtac
ctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcttgtccggctgt
tacacggccgtggccgtggcctacatcgccggcttcctcctggaggaccgagtggtgtgt
aacgacaagttcaccgaggacggggcacgtactgtggcgcagggcaccaagaaggagggc
tgcaccatcctcttcatgatgctgtacttcttcagcatggccagctccatctggtgggtg
atcctgtcgctcacctggttcctggcggcgggcatgaagtggggccacgaggccatcgaa
gccaactcacaatattttcacctggccgcctgggctgtgccggccatcaagaccatcacc
atcctggcgctgggccaggtggacggcgatgtgctgagcggagtgtgcttcgtagggctc
aacaatgtggacgcgctgcgtggcttcgtgctggcacccctcttcgtgtacctgtttatc
ggcacgtcctttctgctggccggctttgtgtcgctcttccgcattcgcaccatcatgaag
cacgatggcaccaagaccgagaagctggagaagctcatggtgcgcattggcgtcttcagc
gtgctgtacactgtgccagccaccatcgtcatcgcctgctacttctacgagcaggccttc
cgggaccagtgggaacgcagctgggtggcccagagctgcaagagctacgctatcccctgc
cctcacctccaggcgggcggaggcgccccgccgcacccgcccatgagcccggacttcacg
gtcttcatgatcaagtaccttatgacgctgatcgtgggcatcacgtcgggcttctggatc
tggtccggcaagaccctcaactcctggaggaagttctatacgaggctcaccaacagcaaa
caaggggagactaccgtctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655547
Entry
104655547         CDS       T03989                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104655547 (FZD10)
   04390 Hippo signaling pathway
    104655547 (FZD10)
   04150 mTOR signaling pathway
    104655547 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104655547 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104655547 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104655547 (FZD10)
   05205 Proteoglycans in cancer
    104655547 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104655547 (FZD10)
   05226 Gastric cancer
    104655547 (FZD10)
   05217 Basal cell carcinoma
    104655547 (FZD10)
   05224 Breast cancer
    104655547 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104655547 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    104655547 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104655547 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104655547 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104655547 (FZD10)
   04090 CD molecules [BR:rro04090]
    104655547 (FZD10)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104655547 (FZD10)
CD molecules [BR:rro04090]
 Proteins
  104655547 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 104655547
NCBI-ProteinID: XP_010353283
LinkDB
Position
10
AA seq 581 aa
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFNWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagcgcccgggcccccgcctgtggctggtcctgcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgcccgggagacggcaaatgccagcccatcgagatcccg
atgtgcaaggacatcggctacaacatgactcgcatgcccaacctgatgggccacgagaac
cagcgcgaggcggccatccaactgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgccgatgtgcaccgagcaggtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctgaagtgctccccgatt
atggagcagttcaacttcaattggcccgactccctggactgccggaaactccccaacaag
aacgaccccaactatctgtgcatggaggcgcccaacaacggctcggacgaacccacccgg
ggctcaggcctgttcccgccgctgttccggccgcagcggccccacagcgcgcaggagcac
ccgctgaaggacggggggcccgggcgcggcggctgcgacaacccgggcaagttccaccac
gtggagaagagcgcgtcgtgcgcgccgctctgcacgcccggagtggacgtgtactggagc
cgcgaggacaagcgcttcgccgtggtctggctggccatctgggccgtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcccgcttccgctaccccgag
cgccctatcatcttcctctccatgtgctactgcgtctactccgtgggctacctcatccgc
ctcttcgccggcgccgagagcatcgcctgcgaccgggacagcggccagctttatgtcatc
caggaggggctggagagcactggctgcacgctggtcttcctggtcctctactacttcggc
atggccagctcgctgtggtgggtggtcctcaccctcacctggttcctggccgccggcaag
aagtggggccacgaggccatcgaagccaacagcagctacttccacctggcagcctgggcc
atcccggcggtgaagaccatcctgatcctggtcatgcgcagggtggcgggggacgagctc
accggggtctgctacgtgggcagcatggacgtcaacgcactcaccggcttcgtgctcatc
cccctggcctgctacctggtcatcggcacgtccttcatcctctcgggcttcgtggccctg
ttccacatccggagggtgatgaagacgggtggcgagaacacggacaagctggagaagctg
atggtgcgtatcgggctcttctctgtgctgtacaccgtgccggccacctgtgtgatcgct
tgctacttttacgaacgcctcaacatggattactggaagatcctggcggcgcagcacaag
tgcaaaatgaacaaccagactaaaacgctggactgcctgatggccgcctccatccccgcc
gtggagatcttcatggtgaaaatcttcatgctgctggtcgtggggatcaccagcgggatg
tggatttggacctccaagactctgcagtcctggcagcaggtgtgcagccgtaggttgaag
aagaagagccggagaaaaccggccagcgtgatcaccagcggtgggatttacaaaaaagcc
cagcacccccagaaaactcaccacgggaaatatgagatccctgcccagccgcccacctgc
gtgtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656419
Entry
104656419         CDS       T03989                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4 isoform X2
  KO
K02354  frizzled 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104656419 (FZD4)
   04390 Hippo signaling pathway
    104656419 (FZD4)
   04150 mTOR signaling pathway
    104656419 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104656419 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104656419 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656419 (FZD4)
   05205 Proteoglycans in cancer
    104656419 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104656419 (FZD4)
   05226 Gastric cancer
    104656419 (FZD4)
   05217 Basal cell carcinoma
    104656419 (FZD4)
   05224 Breast cancer
    104656419 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104656419 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    104656419 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104656419 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104656419 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104656419 (FZD4)
   04090 CD molecules [BR:rro04090]
    104656419 (FZD4)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104656419 (FZD4)
CD molecules [BR:rro04090]
 Proteins
  104656419 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 104656419
NCBI-ProteinID: XP_010354330
UniProt: A0A2K6NDB2
LinkDB
Position
15
AA seq 537 aa
MAWRGAGPSVPGAPGGVGLSLRLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgagcgtcccgggggcgcccgggggcgtcggtctcagt
ctgcggttgctgctgcagttgctgctgctcctggggccggcgcggggcttcggggacgag
gaggagcggcgttgcgaccctatccgcatctccatgtgccagaacctcggctacaacgtg
accaagatgcccaacctggtggggcacgagcttcagacggacgccgagctgcagctgaca
actttcacaccgctcatccagtacggctgctccagccagctgcagttcttcctttgttct
gtttatgtgccaatgtgcacagagaagatcaacatccccattggcccgtgcggcggcatg
tgtctttcagtcaagagacgctgtgaacccgtcctgaaggaatttggatttgcctggcca
gagagtctgaactgcagcaaattcccaccacagaacgaccacaaccacatgtgcatggaa
gggccaggtgatgaagaggtgcccttacctcacaaaacccccatccagcctggggaagag
tgtcactctgtgggaaccaattctgatcagtacatctgggtgaaaaggagcctgaactgt
gttctcaagtgtggctatgatgctggcttatacagccgctcagccaaggagttcaccgac
atctggatggctgtgtgggccagcctgtgcttcatctccactgccttcacagtactgacc
ttcctgatcgattcttctaggttttcctaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagcaggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccacattgcagcctgggccatccccgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcagatgaactgactggcctatgctatgttgga
aaccaaaatctcgatgccctcactgggtttgtggtggctcccctctttacttatttggtg
attggaactttgttcattgctgcaggtttggtggccttgttcaaaattcggtcaaatctt
caaaaggatgggacaaagacagacaagttagaaagactgatggtcaagatcggggtgttc
tcagtactgtacacagttcctgcaacatgtgtgattgcctgttatttttatgaaatctcc
aactgggcactctttcggtattctgcagatgattccaacatggctgttgaaatgttgaaa
atttttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcagaagtgttccaacagattggtgaattctggaaaggtaaagagagag
aaaagaggaaatggttgggtgaagcctgggaaaggcaatgagactgtggtataa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668245
Entry
104668245         CDS       T03989                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104668245 (FZD3)
   04390 Hippo signaling pathway
    104668245 (FZD3)
   04150 mTOR signaling pathway
    104668245 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104668245 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104668245 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    104668245 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668245 (FZD3)
   05206 MicroRNAs in cancer
    104668245 (FZD3)
   05205 Proteoglycans in cancer
    104668245 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104668245 (FZD3)
   05226 Gastric cancer
    104668245 (FZD3)
   05217 Basal cell carcinoma
    104668245 (FZD3)
   05224 Breast cancer
    104668245 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104668245 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    104668245 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104668245 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104668245 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104668245 (FZD3)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104668245 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 104668245
NCBI-ProteinID: XP_010369211
UniProt: A0A2K6RBZ4
LinkDB
Position
9
AA seq 666 aa
MAMTWIVFSFWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgacttggattgtcttctctttttggcccttgactgtgttcatggggcatata
ggtgggcacagtttgttttcctgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacaaacagcagcttta
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcaacgggcttacagtgagtgttcgaagctcatggagatgttcggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactt
gtggatctgaatttagctggagaaccaactgaaggagccccagtggcagtgcagagagac
tatggtttttggtgtccccgggagttaaaaattgatcctgatctgggttattcttttctg
cacgtgcgtgattgttcacctccttgtccaaatatgtacttcaggagagaagaactatca
tttgctcgctatttcataggattgatttcaatcatttgcctctctgccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaggat
cgagtagcctgcaatgcgtccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcgttgctgtttcatgccagtgcatggggcatccctgga
actctaactatcatccttttagcgatgaataaaattgaaggtgataatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cggattgagattccattggaaaaggagaaccaagataaattagtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccgtgtccatatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacttgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcagggagcgtccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacgccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacagatcac
tccaggcatagtagttctcatcggctcaatgagcagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcacatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680216
Entry
104680216         CDS       T03989                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104680216 (FZD5)
   04390 Hippo signaling pathway
    104680216 (FZD5)
   04150 mTOR signaling pathway
    104680216 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104680216 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104680216 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680216 (FZD5)
   05205 Proteoglycans in cancer
    104680216 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104680216 (FZD5)
   05226 Gastric cancer
    104680216 (FZD5)
   05217 Basal cell carcinoma
    104680216 (FZD5)
   05224 Breast cancer
    104680216 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104680216 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    104680216 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104680216 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104680216 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104680216 (FZD5)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104680216 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 104680216
NCBI-ProteinID: XP_010384367
UniProt: A0A2K6NFH9
LinkDB
Position
14
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcgccgccctcgctgctgctgctgctcctggcgcagctg
gtgggccgggcggccgctgcgtccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcaggcctggaggtgcaccagttctggccgctggtggagatccaatgctcgccg
gacctgcgcttcttcctatgctccatgtacacgcccatctgtctgcccgactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctgatg
cgccagtacggcttcgcctggccggagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctctgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcctttcccagccaagcccacccttccaggcccgccaggggcgccggcctctgggggc
gaatgccccgctgggggcccgtccgtgtgcaagtgtcgcgagcccttcgtgcccatcctg
aaggagtcacaccccctctacaacaaggtgcggacgggccaggtgcccaactgcgcggta
ccctgctaccagccgtccttcagtgccgacgagcgcacgttcgccaccttctggatcggc
ctgtggtcggtcctgtgcttcatctccacatccaccacggtggccaccttcctcatcgac
atggaacgcttccgctatcctgagcgccccatcatcttcctgtcagcctgctacctgtgc
gtgtcgctgggcttcctagtgcgcctggtcgtgggccatgccagcgtggcctgcagccgc
gagcacaaccacatacactacgagaccacgggccctgcgctgtgcaccattgtcttcctc
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcctggccgccggcatgaagtggggcaacgaggctatcgcgggctatgcgcagtacttc
cacctggctgcgtggctcatccccagcgtcaagtccatcacggcactggcgctgagctcc
gtggacggggacccggtggccggtatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctgctg
gcgggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtgccc
gccagcatcgtggtggcttgctacctgtacgagcagcactaccgcgagagctgggaggcg
gcgctcacctgcgcctgcccgggccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggcgtctgg
atctggtcgggcaagacggtggagtcgtggcggcgtttcaccagccgctgctgttgccgc
ccgcggcgcggccacaagagcgggggcgccatggccgctggggactaccccgaggcgagc
gccgctctcacaggcaggaccgggccgccaggccccgccgccacctaccacaagcaggtg
tccctgtcgcacgtgtag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680806
Entry
104680806         CDS       T03989                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104680806 (FZD7)
   04390 Hippo signaling pathway
    104680806 (FZD7)
   04150 mTOR signaling pathway
    104680806 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104680806 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104680806 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680806 (FZD7)
   05205 Proteoglycans in cancer
    104680806 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104680806 (FZD7)
   05226 Gastric cancer
    104680806 (FZD7)
   05217 Basal cell carcinoma
    104680806 (FZD7)
   05224 Breast cancer
    104680806 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104680806 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    104680806 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104680806 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104680806 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104680806 (FZD7)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104680806 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 104680806
NCBI-ProteinID: XP_030772938
LinkDB
Position
14
AA seq 574 aa
MPDPGAAAPRLSLGLCALMLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgccggaccccggcgcggccgcccctcgcttgtccctgggcctctgcgccctgatgctg
gcgctgctgggcgcgctgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgaactccgcttc
ttcctatgctccatgtacgcgcccgtgtgcaccgtgctagatcaggccatcccgccgtgt
cgttctctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggtttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggcgcgggcgagatctgc
gtgggccagaacacgtcagacggctccgggggtccaggcggcggccccactgcctaccct
accgcgccctacctgccggacctgcccttcaccgcgctgcctccgggggcctcagatggc
agggggcgtcccgccttccccttctcatgcccccgtcagctcaaggtgcccccctacctg
ggctaccgcttcctgggtgagcgggattgcggcgccccgtgcgaaccgggccgtgccaat
ggcctgatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tcggtgctgtgctgcgcctctacgctctttaccgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcgacccatcatcttcttgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttccttctggaggaccgcgccgtgtgcgtggagcgcttctcg
gacgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctttacttcttcggcatggccagctccatctggtgggtcattctgtctctcact
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcacagtac
ttccacttggccgcgtgggccgtgcccgccgtcaagaccatcactatcctggccatgggc
caggtagacggggacctgctcagcggggtgtgctacgttggcctgtccagtgtggacgcg
ctgcggggcttcgtgctggcgcctctgttcgtctacctcttcatcggcacgtccttcctg
ctggccggcttcgtgtccctcttccgtatccgcaccatcatgaaacacgacggcaccaag
accgagaagctggagaagctcatggtgcgcattggcgtcttcagcgtgctctacacagtg
cctgccaccatcgtgctggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcttgcagacgtgcaagagctatgccgtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcacggtcttcatgatcaagtacttgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggaaactgcggtatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681229
Entry
104681229         CDS       T03989                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104681229 (FZD9)
   04390 Hippo signaling pathway
    104681229 (FZD9)
   04150 mTOR signaling pathway
    104681229 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104681229 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104681229 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104681229 (FZD9)
   05205 Proteoglycans in cancer
    104681229 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104681229 (FZD9)
   05226 Gastric cancer
    104681229 (FZD9)
   05217 Basal cell carcinoma
    104681229 (FZD9)
   05224 Breast cancer
    104681229 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104681229 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    104681229 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104681229 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104681229 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104681229 (FZD9)
   04090 CD molecules [BR:rro04090]
    104681229 (FZD9)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104681229 (FZD9)
CD molecules [BR:rro04090]
 Proteins
  104681229 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 104681229
NCBI-ProteinID: XP_010385756
LinkDB
Position
6
AA seq 591 aa
MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDLGPGAGGGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALIWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CYRKMAAGRARAKACRVPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtggcaccgctgcggggggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcgctggagatcggccgcttcgacccggaacgcgggcgcggggctgcgccgtgccag
gcagtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggtcacacgtcgcagggcgaggcggccgccgagctggcggagttcgcgccgctggtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgc
accgaccaggtctcgacgcccattcccgcctgcaggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaactttggctggcccgactcgctcgactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctgtgcatggaggcgcccgagaacgccacg
gccggccccgcagagccccacaagggcctgggcatgctgcccgtggcgccgcggcccgcg
cgccctcccggagacctgggcccgggcgcgggcggcggtggcacctgcgagaaccccgag
aagttccagtacgtggagaagagccgctcgtgcgcaccccgctgcgggcccggcgtcgag
gtgttctggtcccggcgcgacaaggacttcgcgctgatctggatggccgtgtggtcggcg
ctgtgcttcttctccaccgccttcaccgtgctcaccttcctgctggagccccaccgcttc
cagtaccccgagcgccccatcatcttcctctccatgtgctacaacgtctactcgctggcc
ttcctgatccgtgcggtggccggagcgcagagcgtggcctgtgaccaggaggcgggtgcg
ctctacgtgatccaggagggcctggagaacacggggtgcacgctggtcttcttgctcctg
tactacttcggcatggccagctcgctctggtgggtggtcctgacgctcacctggttcctg
gcggctgggaagaaatggggccacgaggccatcgaggcccacggcagctacttccacatg
gctgcctggggcctgcccgcgcttaagaccatcgtcatcctgactctgcgcaaggtggca
ggggatgagctgactgggctctgctacgtggccagcacggatgcggcggcgctcacgggc
ttcgtgctggtgcccctctccggctacttggtgctgggcagtagtttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacgggtggcaccaacacagagaag
ctggagaagctcatggtcaagatcggagtcttctccatcctctacacggtgcccgccacc
tgtgtcatcgtttgctatgtctatgaacgcctcaacatggacttctggcgccttcgggcc
acagagcaaccatgcgcagcggccgcggggcccggaggccggagggactgctcgctgcca
gggggctcggtgcccaccgtggctgtcttcatgctcaaaatcttcatgtcactggtggtg
gggatcaccagcggcgtctgggtgtggagctccaaaactttccagacctggcagagcctg
tgctaccgcaagatggcagctggccgggcccgggccaaggcctgccgggtccccgggggc
tacggccgtggcacgcactgccactataaggctcccaccgtggtcttgcacatgactaag
acggacccctctctggagaaccccacacacctctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682682
Entry
104682682         CDS       T03989                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04150  mTOR signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04916  Melanogenesis
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104682682 (FZD8)
   04390 Hippo signaling pathway
    104682682 (FZD8)
   04150 mTOR signaling pathway
    104682682 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104682682 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104682682 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682682 (FZD8)
   05205 Proteoglycans in cancer
    104682682 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104682682 (FZD8)
   05226 Gastric cancer
    104682682 (FZD8)
   05217 Basal cell carcinoma
    104682682 (FZD8)
   05224 Breast cancer
    104682682 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104682682 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    104682682 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104682682 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104682682 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104682682 (FZD8)
G protein-coupled receptors [BR:rro04030]
 Frizzled / Smoothened family
  104682682 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz PhaG_MnhG_YufB
Other DBs
NCBI-GeneID: 104682682
NCBI-ProteinID: XP_030797371
LinkDB
Position
11
AA seq 693 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPNPPRRLPPPPPGEQPPSGS
GHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVS
VSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFL
IDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGA
GAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDN
LRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLY
TVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITS
GVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGQPGGGGGGVPGGGGPGGG
AGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctggccgccttagcgctgctgcag
cgctctagcggcgcggcggccgcctcggccaaggagctggcgtgccaagagatcaccgtg
ccgctgtgtaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgtcagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgcccgaa
cagggcaaccctgacacgctgtgcatggactacaaccgcaccgacctcaccaccgctgcg
cccaatcccccgcgccgcctgccgccgccgccgcccggcgagcagccgccctcgggcagc
ggccacggccgcccgccgggggccaggcccccgcatcgcggcggcggcaggggcggtggc
ggcggggacgcggcggcacccccagctcgcggtggcggcggtggcgggaaggcgcggccc
cctggcggcggcgcggctccctgcgagcccgggtgccagtgccgcgcgcccatggtgagc
gtgtccagcgagcgccacccgctctacaaccgcgtcaagacaggccagatcgccaactgc
gcgctgccctgccacaaccccttcttcagccaggacgagcgcgccttcaccgtcttctgg
atcggcctgtggtcggtgctctgcttcgtgtccaccttcgccaccgtctccaccttcctc
atcgacatggagcgcttcaagtacccggagcggcccatcatctttctctcggcctgctac
ctcttcgtgtcagtgggctacctggtgcgcctggtggcgggccacgagaaggtggcgtgc
agcggcggcgcgccgggcgcgggcggtgcgggcggcgcgggcggcgcggcggcgggcgcg
ggtgcggcgggcgcgggcgcgggaggcccgggcgggcgcggcgagtacgaggagctcggc
gcggtggagcagcacgtgcgctatgagaccaccggccccgcgctgtgcaccgtggtcttc
ttgctggtctacttcttcggcatggccagttccatctggtgggtgattttgtcgctcacg
tggtttctggcggccggcatgaagtggggcaacgaagccatcgccggctactcgcagtac
ttccacctggccgcatggctcgtgcccagcgttaagtccatcgcagtgctggcgctcagc
tcggtggacggcgacccagtggcgggcatctgctacgtgggcaaccagagcctggacaac
ctgcgcggcttcgtgctggcgccgctggtcatctacctcttcattggcaccatgttcctg
ctggccggcttcgtgtcgctcttccgcatccgctcagtcatcaagcagcaggacggccct
accaagacgcacaagctggagaagctgatgatccgcctgggcctgttcaccgtgctctac
accgtgcctgcggcggtggtggtcgcctgcctcttctacgagcagcacaaccgcccgcgc
tgggaggccacgcacaactgcccgtgcctgcgggacctacagcctgaccaggcgcgcagg
cccgactacgccgtcttcatgctcaagtacttcatgtgcctagtggtgggcatcacctcg
ggcgtgtgggtctggtctggcaagacgctggagtcctggcgctccctgtgcacccgctgc
tgctgggccagtaagggcgccgcagtgggcgggggcgcgggcgccacggccgcggggggc
ggcggccagccagggggcggtggcgggggggtgcccggcggcggggggccgggcggtggc
gcgggctccctctacagcgacgtcagcaccggcctgacgtggcggtcgggcacggccagc
tccgtgtcttatccaaagcagatgccattgtcccaggtctga

DBGET integrated database retrieval system