KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654731
Entry
104654731         CDS       T03989                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104654731 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104654731 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104654731 (GFAP)
Membrane trafficking [BR:rro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    104654731 (GFAP)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     104654731 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 Topoisom_I_N GAS
Other DBs
NCBI-GeneID: 104654731
NCBI-ProteinID: XP_010352304
UniProt: A0A2K6PZ80
LinkDB
Position
19
AA seq 432 aa
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLGTVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQELLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagaggagacgcatcacctctgctgctcgccgctcctacgtctcctcgggggagatg
atggtggggggcctggctcctggccgccgtctgggtcctggcacccgcctctccctggct
cgaatgccccctccactcccgacccgggtggacttctccctggctggagcactcaatgct
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgcttc
gccagctacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgag
ctgaaccagctgcgggccaaggagcccaccaagctggccgacgtctaccaggctgagctg
cgagagctgcgactgcggctcgatcaactcaccgccaacagtgcccggctggaggtcgag
agggacaatctggcacaggacctgggcaccgtgaggcagaagctccaggatgaaaccaac
ctgaggctggaagccgagaacaacctggctgcctatagacaggaagcagatgaagccacc
ctggcccgtctggatctggagaggaagattgagtcgctggaggaggagatccggttcttg
aggaagatccacgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtc
catgtggagctggacgtggccaagccagacctcaccgcagccctgaaagagatccgcacg
cagtatgaggcaatggcgtccagcaacatgcatgaagctgaggagtggtaccgttccaag
tttgcagacctgacagacgctgctgcccgcaacgcggagctgctccgccaggccaagcac
gaggccaacgactaccggcgccagttgcagtccttgacctgcgacctggagtctctgcga
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcgccacgcgcgggag
gcggccagttaccaagaggcgctggcgcggctggaggaagaggggcagagcctcaaggac
gagatggcccgccacttgcaggagtaccaggagctgctcaacgtcaagttggccctggac
atcgagatcgccacctacaggaagctgctggagggcgaggagaaccggatcaccattcct
gtgcagaccttctccaacctgcagatccgagaaaccagcctggacaccaagtctgtgtca
gaaggccacctcaagaggaacatcgtggtgaagaccgtggagatgcgggatggagaggtc
attaaggagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system