KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654785
Entry
104654785         CDS       T03989                                 

Gene name
PKD1L3
Definition
(RefSeq) LOW QUALITY PROTEIN: polycystic kidney disease protein 1-like 3
  KO
K04989  polycystin 1L3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104654785 (PKD1L3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104654785 (PKD1L3)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   104654785 (PKD1L3)
SSDB
Motif
Pfam: PKD_channel PLAT GPS Ion_trans Lectin_C
Other DBs
NCBI-GeneID: 104654785
NCBI-ProteinID: XP_010352383
LinkDB
Position
20
AA seq 1731 aa
MFFKGGSWLWLYIRTSIILGSELNSPGPHRQNNCYQFNRIHCSFEEAEHYCQGQRGFLAD
IWKQEVQDLIRDFLEEGKKWWIGQNVMPLKKHQDEKYPADVAAHGAPKPPSCTYLSRNVN
RISSKEGKCFLRHYFICQTDGILDRDAHYERNGNDSHLYQRPEKTKRGVEIARDKTPPGP
GPLSTSCHHPLPAHLSKTLCHPISPFPSVLQNITSQVTATSEPSSQPLPVITQLTTPVSV
THAGQSMAETTSSPKEAAHLNTVTSHLQVSLHNASGQVVDETAGNFSRAVHGLQAHNKLQ
EACEFLQKLTALTPRFVKPAQVNLINSLIYLSEELLRIPFLNNSSLDFKVHATVCPFHSC
NDVIKAEEGSWLESKRDTEQVEDILEMSLAELGNIGEAFLEQNRSSESSVTLTSSIASLL
LSRQNTSTLPLSSYTLGHPAPVRLGFPSALALKELLNQHPGVNVQVTGLAFNPFKDLDHR
NVVGSVGSVLLSANRKLLQVHDLVEDIEIMLWRNISMETHPTSFNMSTDQLTITVNITSL
EKSLIVSIDPDSPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLTPEHLQH
GIGTYCIRAVLSESQKGAQQTPSLVSVITAVTQCYYWESHNQTWSSNGCQVGPQSTILRT
QCLCNHLTFFASDFFVVPRTVNVEDTVELFLRVTNNPVGVSLLAGLLGFYVITVVWAWKK
DQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRRAATTAKVVVTLYGSEGRSEPHHLCD
PQKTVFERGGLDVFLLTTRSPLGDLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHFL
CNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSVATRHPWNQFT
RVQRLSCCMTLLLCNMVINVMFWKINSTTAKRDEQLGPFAVAWSELLISIHTAVILFPIN
LVIGRLFPLIEPQETLPLFPPVQASCLSDASVEPLSATMVVEELKETVRFLLRRNTYLLS
KCEQPPWSSCDITKLVKLLSSLISSHLEGQSCHQQTERHLARVVPENHHHFCCYLRRVLQ
RLKSHLGTLGLTQGHQPCDFLDAASQLQKLQELLETHILPTEQEPSREVTSFAILSSEEG
KKFISNGLSKWLTAVCWLLLGLTSLASAFFTALYSLELSKDQATSWMISIILSVLQNIFI
SQPGKVVFFTFLYSLMISRMPRLNKEKEQQTKRILALLAKCSSSVPGSRDKNNPVYVAPA
MNSPTKRPERTLKKKKLFKLTGDILVQILFLTLLMTAICSVKDSNRFYLHQAIWKTFSPR
FSEIKLLQDFYPWANHILLPGLYGDYRGKSAVLKPSHCKYGVQLIFQIPCTTIYEKVKEG
QLVFSDXGRTCGHPKSLFPGLHLRRFSYICSPRPKGPIPADELHKRLTSKNDSGFSYIMR
SAFFTSVSLESFTSLQMSKKGFAWSVISQVIYYLLVCYYAFIQGCRLKWQKWRFFTGRRN
ILDTSIILISFIILGLDMKSISLLRKNMARYRDDQDRFISFHEAVKVNSAATHLVGFLVL
LATVQLWNLLRHSPRLRVISRTLSQAWDEVVGFLLIILILLTGYAVAFNLLFGCSISDYR
TFFSSAVTVVGLLMGISHQEEVIDLDPVLGTFLILTSVILMVLVVINLFVSAILMAFGKE
RKSLKKEVALIDMLLQKLSNLLGISRPQKTSSEQAATTAMGTDTGVLDELP
NT seq 5196 nt   +upstreamnt  +downstreamnt
atgttctttaaaggaggaagctggctttggttatacatcagaacaagtatcattctagga
agtgaactaaacagcccagggccacataggcaaaataattgttaccagtttaacagaatt
cactgcagctttgaggaagcagagcattactgtcaggggcagagaggattcctagctgac
atttggaagcaggaagttcaagatctcatccgggactttctggaagaaggaaagaagtgg
tggattgggcaaaatgtaatgccactgaaaaagcatcaagatgaaaaatacccagcagat
gttgcagcccacggggccccaaagccccccagctgcacctacctgtccagaaacgtcaat
cggatctcatccaaagagggcaagtgcttcctgagacactatttcatttgccagactgat
ggcattttggacagagatgcccattatgaaagaaatggaaatgattctcatttgtaccag
agacccgagaagacaaaaagaggagttgaaatagcaagagacaaaacgcccccaggacct
ggtcctctttcaacctcatgtcaccatcctcttcctgctcatctgtccaagaccctgtgt
catcccatcagcccgtttccttcagtactacaaaatatcacatcacaggtaacagccaca
tctgaacccagcagccagcctctgcctgtgataacacagctcaccacgcctgtgtctgtc
acacatgctgggcaatctatggcagaaacaacttcaagcccaaaggaagcagctcatctg
aataccgtcacctctcatttacaagtgtcattgcataatgcatctggtcaggtcgtagat
gagacagcagggaacttcagcagagcagttcatggtttgcaagctcataacaaactacag
gaagcttgtgagttcctccagaaactaacagccttaaccccaagatttgttaagccagct
caggttaatctcatcaattcccttatttacctgagtgaggagttactcaggatcccattt
ctgaacaacagcagtctggacttcaaagttcatgcgactgtctgcccctttcattcctgc
aacgatgtcatcaaagctgaagaaggaagttggctggaatccaagcgtgatactgagcag
gtagaagacatcctggaaatgtccttggcagagcttgggaatatcggggaagcatttcta
gagcagaaccggtcttccgagtcttcagtgactttgacctcctccattgctagtctgctg
ctgagcagacaaaacacatccaccttaccactgagctcttacactctgggtcacccagcc
cctgtgagattgggctttccgtcggctttggctttgaaggagctcttgaatcaacaccca
ggagttaatgtccaagtaacaggactagctttcaatcccttcaaggatttggaccacaga
aacgttgttggaagcgttggaagtgtgttactaagcgctaatcgcaaattgctccaagtc
catgatttagtggaggacattgagattatgctctggagaaacattagcatggaaacccat
cccaccagcttcaacatgagcacagatcagcttacaatcacagtgaacatcacctccttg
gagaaatccctgatagtgagcatagatcctgacagtccccttttaatgacgctctacctg
gggttccagtatcagcctaactgtactcacttccacctgaacatcacccttccgaaggac
aaggtgtggcaaaaagatgaggagtacacgtgggtgctgactcctgagcatctacagcac
gggattggcacctactgtataagagctgtgctgagtgagagccagaagggtgctcagcag
acgcccagcttggtctcggtcatcacggccgtcactcagtgttattactgggagagccac
aaccagacatggagcagcaacggatgccaagttgggccacagagcacaattctgaggaca
cagtgtctctgtaaccacctgaccttctttgccagcgacttctttgtcgtgcccaggacc
gtgaatgttgaagacacggtggaactgttccttcgcgtgactaacaatcctgttggggtg
tcactgctggctggccttttaggattctatgtgatcacagttgtgtgggcttggaaaaag
gatcaagcagatatgcagaaggtgaaggtcactgtcctggctgataatgaccccagcgct
caatttcactaccttattcaggtctacaccggatatcgaagaagggctgctacaacagct
aaggttgtcgtcaccctctatggatcagagggacggagcgagccccatcacctctgtgac
ccccagaagacagtctttgaacgagggggcctggacgtcttccttctcaccactcggtcc
cctctaggggacctgcacagccttcggctctggcatgacaattccggcgtcagtccctcc
tggtatgtcagccaggtaattgtctgtgacatggcagtgaagaggaagtggcatttcctg
tgtaattgctggctggctgtggaccttggagactgtgagcttgaccgggtcttcatccca
gtttcaaagagagagctcttttcctttagacatctgttttcctccatgattgtagaaaag
ttcacccaggattatctgtggctttcagttgcaactcggcatccctggaaccagtttaca
agggtccaacggctgtcttgctgcatgacactgctactctgcaacatggtcatcaatgtt
atgttctggaagataaacagcaccactgccaagagagatgagcaattgggtccatttgct
gtggcctggtctgagctgctgatcagcatccacactgctgtcatcctcttccccatcaat
cttgtcattgggcggctcttcccgttgattgagccacaggagactctgcccctctttcct
cccgtccaggcctcctgcctctcagatgcttctgttgagcctctctctgccacaatggta
gttgaggaattaaaggaaactgtgagattcctgctcaggagaaatacatacctactctcc
aagtgtgagcagccgccatggagttcttgtgacattactaagctggtgaaacttttatcc
agcctcatatcgtctcacttggagggtcaaagctgtcatcagcagacagagcgccacttg
gcacgtgttgttcctgaaaaccaccatcatttctgctgttacctgcgtagagttctgcag
aggctgaaatctcacttaggcacgctgggtctcacccagggtcaccagccctgtgacttc
ctagatgcagccagccaacttcaaaaactccaggaactcttggaaacacacattcttccc
acagagcaagagccatccagagaagtcaccagttttgccatcctaagctcagaagaagga
aaaaagttcatctctaatggcctgtccaaatggttgactgcagtctgctggctcctccta
ggtctcactagcctggcttcagccttttttacagcactttatagcttggaattgagcaaa
gaccaagccaccagctggatgatttcaattattttatcagtgcttcaaaacatcttcatc
agccagccaggaaaggtggtcttcttcacattcttatactcactgatgataagcaggatg
ccacggcttaacaaagagaaggaacaacaaacaaagaggatcttggcgctcttggcaaaa
tgttcttcgtcagtaccaggttcaagagataagaacaaccctgtctatgtagccccagct
atgaatagtccaactaagcgtccagaaagaaccttgaaaaagaagaaactcttcaagctg
actggagatattttggtacaaatccttttccttaccctattgatgactgcaatctgctct
gtaaaggactccaatagattttacctccaccaagctatctggaagaccttttcgccccga
ttctcggaaatcaaacttcttcaggatttctacccctgggctaatcacatcctccttcct
ggcctgtatggggattacagaggtaagagtgcagtcctgaagcccagtcattgcaaatat
ggggtacaattaattttccaaataccctgtaccacgatctatgagaaagtgaaggaaggt
cagctggtgttttctgatnatggccgtacctgtgggcatcccaagagcttgttccctgga
cttcatctaaggaggttcagttacatctgttcacccaggcccaaggggccgattcctgct
gatgagcttcacaaaaggctgacaagcaagaatgacagtggattcagttacatcatgaga
agtgctttcttcacctcggtgagcctggaaagcttcacttcccttcagatgtcaaagaag
ggctttgcctggtctgtcatctcacaagtcatctattatctactggtctgttactatgcc
ttcatacagggttgtcggctgaaatggcagaagtggaggttcttcactgggagaagaaac
attctggacacaagtataatcctcattagcttcatcatcctggggcttgacatgaagagt
atttctctacttaggaaaaacatggcacgataccgcgatgaccaggacaggtttatcagc
ttccacgaggcagtaaaagtgaactctgctgcgactcaccttgtgggcttcctggttctg
ctggcaaccgttcagttatggaacctgctgcgtcacagccccaggttgcgggtcatcagc
aggacactgagccaagcctgggacgaggtggtgggctttctgctgatcatcctaatcctg
ctgacaggctatgccgttgcctttaacctgctgtttggatgcagcatctctgactaccgg
acatttttcagctcagcagtgactgttgttggtctcctgatgggaatttctcaccaagag
gaggttatcgatttagacccagtcctgggcacctttctgattctcaccagtgtcatcttg
atggtacttgtggtaattaatctttttgtttctgccattctcatggcctttggaaaagaa
agaaagtcgcttaagaaagaagttgcactaatagatatgctgctacagaagctctcaaat
ttgttaggaatcagtcggccccaaaaaacctcatctgagcaagcagccacgacagcaatg
ggcactgacactggagttttagatgaactaccttaa

DBGET integrated database retrieval system