KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654795
Entry
104654795         CDS       T03989                                 

Gene name
PRL
Definition
(RefSeq) prolactin isoform X1
  KO
K05439  prolactin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104654795 (PRL)
   04151 PI3K-Akt signaling pathway
    104654795 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104654795 (PRL)
   04060 Cytokine-cytokine receptor interaction
    104654795 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104654795 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104654795 (PRL)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104654795 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104654795
NCBI-ProteinID: XP_010352397
UniProt: A0A2K6PLN2
LinkDB
Position
4
AA seq 228 aa
MNIKGSPWKAGSLLLLLVSNLLLCQNVAPLPVCPGGAARCQVTLRDLFDRAVVLSHYIHN
LSSEMFSEFDKRYTHGRGFITRTINSCHTSSLPTPEDKEQAQQINQKDFLSLIVSILRSW
NEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWS
GLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagcagggtccctcctgctgctgctggtgtcaaac
ctgctcctgtgccagaacgtggccccgttgcccgtctgtcctggtggggctgccagatgc
caggtgacccttcgagacctgtttgaccgcgcagtcgtcctgtcccactacatccataac
ctctcctcagaaatgttcagcgaattcgataaacggtatacccatggccggggattcatt
accaggaccattaacagctgccacacttcttcccttcccacccccgaagacaaggagcaa
gcccaacagatcaatcaaaaagactttctgagcctgatagtcagcattttgcgatcctgg
aatgagcccctgtatcatctagtcacagaagtacgtggtatgcaagaagccccggaggct
atcttatccaaagccgtagagatcgaggagcaaaccaaacggcttctagagggcatggag
ctgatagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggtcg
ggacttccatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctg
ctccactgcctacgcagggattcacataagatcgacaattatctcaagctcctgaagtgc
cgaatcatccacaacaacaactgctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655117
Entry
104655117         CDS       T03989                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X1
  KO
K05423  granulocyte colony-stimulating factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro04657  IL-17 signaling pathway
rro05144  Malaria
rro05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104655117 (CSF3)
   04151 PI3K-Akt signaling pathway
    104655117 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104655117 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104655117 (CSF3)
   04657 IL-17 signaling pathway
    104655117 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104655117 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    104655117 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104655117 (CSF3)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104655117 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6 Img2 NAGLU
Other DBs
NCBI-GeneID: 104655117
NCBI-ProteinID: XP_010352801
UniProt: A0A2K6P8H9
LinkDB
Position
19
AA seq 204 aa
MAVPAAQSPVKLMALQLLLWHSALWTVQEATPLDPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSGLFLYQGLLQ
ALEGISPELGPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGG
VLVASHLQRFLELAYRVLRHLAQS
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctgtacctgccgcccagagccccgtgaagctgatggccctgcagctgctgctgtgg
cacagcgcactctggacagtacaggaagccacccccctagaccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtaaggaagatccagggcgatggtgccgcg
ctgcaggagaagctgtgtgccacctacaagctgtgccaccccgaggagctggtgctgctt
agacactctctgggcatcccctgggctcccctaagcagctgccccagccaggccctgcag
ctgacaggctgcttgagccaactccatagtggcctattcctctaccaggggctcctgcag
gccctggaagggatctcccctgagttgggccccaccttggatacactgcagctggatatt
gccgactttgccaccaccatctggcagcagatggaagacctgggaatggcccctgccctg
cagcccacccagggtgccatgccagccttcacctctgccttccagcgccgggcgggaggc
gtcctggttgcctcccatctgcagcgcttcctggagctagcgtaccgcgttctacgccac
cttgcccagtcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104664621
Entry
104664621         CDS       T03989                                 

Gene name
THPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombopoietin
  KO
K06854  thrombopoietin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104664621 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104664621 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104664621 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104664621 (THPO)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104664621 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 104664621
NCBI-ProteinID: XP_010364464
LinkDB
Position
1
AA seq 493 aa
MNPPIQVFSRVCVGGGVDPGPGRGSREEKASLPGAFASVWWFPPLIGQKWPRQPCDLLLW
RGFAPPPHVFQPICSPEGCLLCTWVLEPLSTWIDSSSLARLXPTLLCPEVQEPKPPPWPQ
EGFRGEAPNREPRQPDTPARMELTELLLVVMLLLTARLTLSSPAPPACDPRVLSKLLRDS
HVLHSRLSLCPEVNPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARG
QLGPTCLSSLLGQLSGQVRLLLGVLQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKV
RFLLLVGGPTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLQK
RQQGFRAKIPGLLNQTSRSLDQIPGYLNKIHELLNGTRGLFPGPSRRTLGAPDISPGTSD
TGSLPPKLQPGYSPSPTHPPTGQYTLFPLPPTLPSPVVQLHPLLPDPSAPTPTPTSPLLN
TSHTHSQNLSQEG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaatccccctatccaagtcttctccagggtgtgtgtgggtggaggagtggaccctggt
ccaggcaggggctccagggaagagaaggcgtcacttccgggggccttcgccagtgtctgg
tggttccctcctctgattgggcagaagtggcccaggcagccgtgtgacctgctgctgtgg
aggggctttgccccaccgccacatgtcttccaacccatctgctccccagagggctgcctg
ctgtgcacttgggtcctggagcccttatccacctggatagattcctcatccttggcccgc
ctttgacccaccctactctgcccagaagtgcaagagcccaagccgcctccatggccccag
gaaggattcaggggagaggccccaaacagggagccacgccagccagacaccccggccaga
atggagctgactgaattgctcctcgtggtcatgcttctcctaactgcaaggctaactctg
tccagcccggctcctcctgcctgtgacccccgagtcctcagtaaactgcttcgtgactcc
catgtccttcacagcagactgagcctgtgcccagaggttaaccctttgcccacacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggagaccaag
gcacaggacattctgggagcagtgacccttctgctggagggagtgatggcagcacgggga
caactgggacccacttgcctctcatccctcctggggcagctttctggacaggtccgtctc
ctccttggggtcctgcagagcctccttggaacccagcttcctccacagggcaggactaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgctgcttgtaggagggcccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcggccagaactactggctctggacttcagaag
cggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccccggatacctgaacaagatacacgaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagccccggacatttccccaggaacatcagac
acaggctccctgccacccaaactccagcctggatattctccttccccaacccatccccct
actggacagtacacactcttccctcttccacccaccttgccctcccctgtggtccagctc
caccccctgcttcctgacccttctgctccaacacccacccctaccagccctcttctaaac
acatcccacacccactcccagaatctgtctcaggaagggtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673627
Entry
104673627         CDS       T03989                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04066  HIF-1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04640  Hematopoietic cell lineage
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104673627 (EPO)
   04066 HIF-1 signaling pathway
    104673627 (EPO)
   04151 PI3K-Akt signaling pathway
    104673627 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104673627 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104673627 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673627 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104673627 (EPO)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104673627 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 104673627
NCBI-ProteinID: XP_010376036
UniProt: A0A1L1WKB9
LinkDB
Position
6
AA seq 193 aa
MGVHECPAWLWLLLSLLSFPLGLPVPGAPPRLICDSRVLERYLLEAKEAENVTMGCSESC
SLNENITVPDTKVNFYAWKRMEVGQQALEVWQGLALLSEAVLRGQAVLANSSQPCKPLQL
HVDKAISGLRSITTLLRVLGAQQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKL
KLYTGEACKRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcattccct
ctgggcctcccagtcccgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggctgagaatgtcacgatgggctgttccgaaagctgc
agcttgaatgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg
atggaggtcgggcagcaggccctagaagtctggcagggcctggccttgctctcagaagct
gtcctgcggggccaggccgtgttggccaactcttcccagccttgcaagcccctgcagctg
cacgtggataaagccatcagtggccttcgcagcatcaccactctgcttcgggtgctggga
gcccagcaggaagccatctcccttccagatgcagcctccgctgctccactccgaacaatc
actgctgacactttctgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacgggggaggcctgcaagagaggggacagatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674424
Entry
104674424         CDS       T03989                                 

Gene name
LEP
Definition
(RefSeq) leptin precursor
  KO
K05424  leptin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04152  AMPK signaling pathway
rro04630  JAK-STAT signaling pathway
rro04920  Adipocytokine signaling pathway
rro04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104674424 (LEP)
   04152 AMPK signaling pathway
    104674424 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104674424 (LEP)
   04060 Cytokine-cytokine receptor interaction
    104674424 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104674424 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104674424 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104674424 (LEP)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104674424 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 104674424
NCBI-ProteinID: NP_001289857
UniProt: F1AWN9
LinkDB
AA seq 167 aa
MYWRPLCGFLCLWPYLFYIQAVPIQKVQSDTKTLIKTIVTRINDISHTQSVSSKQRVTGL
DFIPGLHPVLTLSQMDQTLAIYQQILINLTSRNVIQISNDLENLRDLLHLLAFSKSCHLP
LASGLETLESLGGVLEASLYSTEVVALSRLQGSLQDMLWQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtattggagacccctgtgtggattcttgtgtctttggccctatctgttctacatccaa
gctgtgcccatccagaaagtccaaagtgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcggtctcctccaaacagagggtcaccggtttg
gacttcattcctgggctccaccccgtcctgaccttatcccagatggaccagacactggca
atctaccaacagatcctcatcaatctgacttccagaaacgtgatccaaatatccaacgac
ttggagaacctccgggaccttcttcacctgctggccttctctaagagctgccacttgccc
ttggccagtggcctggagaccttggagagcctggggggtgtcctggaagcttcactctac
tccacggaggtggtggccctgagcaggctgcaggggtctctacaggacatgctgtggcag
ctggacctcagccctgggtgctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675453
Entry
104675453         CDS       T03989                                 

Definition
(RefSeq) somatotropin isoform X1
  KO
K05438  growth hormone
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675453
   04151 PI3K-Akt signaling pathway
    104675453
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104675453
   04060 Cytokine-cytokine receptor interaction
    104675453
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104675453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675453
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104675453
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104675453
NCBI-ProteinID: XP_010378328
UniProt: Q4VUJ1
LinkDB
Position
19
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGTSDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNND
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgcctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccgacaccctccaacagggaggaaacgcagcagaaatccaacctagag
ctactccgcatctccctactgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtgtttgccaacagcctggtgtatggcacctcagacagcgacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagtttgacacaaactcacacaacaatgat
gcactgctcaagaactacgggctgctctattgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttttag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675456
Entry
104675456         CDS       T03989                                 

Definition
(RefSeq) somatotropin-like isoform X1
  KO
K05438  growth hormone
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675456
   04151 PI3K-Akt signaling pathway
    104675456
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104675456
   04060 Cytokine-cytokine receptor interaction
    104675456
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104675456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675456
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104675456
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104675456
NCBI-ProteinID: XP_030779078
LinkDB
Position
19
AA seq 217 aa
MAVGSRTSLLLAFALLCLPWLQEAGRVPSVPLSRLFDHAMIEAHRLHQLAFDTYQEFEET
YIPKEKKHSIMENPQASFCFSDSIPTPSNMEETQEKSNLELLRISQLLIQSWLEPVQFFS
SVFTNNLVHGTSDSDVHDLLKNLEEGIETLMGRLDDGSPRTGQIFKQTYSKFDTNSHDDD
ALLKNYGLLHCFRKDMDMVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgtaggctcccgcacatccctgctcctggcttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtcccaagcgtacccttatccaggctttttgaccacgctatg
atcgaagcccatcgcctgcaccaactggcctttgacacctaccaggagtttgaagaaacc
tatatcccaaaggaaaagaagcattcgatcatggagaacccccaggcctccttctgcttc
tcagactctattcccacaccctccaacatggaggaaacgcaggagaaatccaacctagag
ctgctccgcatctcccagctgctcatccagtcctggctggagcccgtgcagttcttcagc
agtgtgtttaccaacaacctggtgcatggcacctcggacagcgacgtccatgacctccta
aagaacctagaagaaggcatcgaaacgttgatggggaggctggacgatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagtttgacacaaactcgcacgacgatgac
gcactgctcaagaactatgggctgctccactgcttcaggaaggacatggacatggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675458
Entry
104675458         CDS       T03989                                 

Definition
(RefSeq) somatotropin-like isoform X2
  KO
K05438  growth hormone
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675458
   04151 PI3K-Akt signaling pathway
    104675458
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104675458
   04060 Cytokine-cytokine receptor interaction
    104675458
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104675458
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675458
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104675458
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104675458
NCBI-ProteinID: XP_010378335
LinkDB
Position
19
AA seq 139 aa
MAAESIPTPSNMEETQQKSNLELLHISVLLIQSWLEPVQFLKSVFANRQVYGTSDSGVYD
LLKSLEEGIQTLMGRLEDGSPWTGQIFKQTYSKFDTNSHNDDTLLKNYWLLHCFRKDMNK
VETFLRMVQCRSVEGSCGF
NT seq 420 nt   +upstreamnt  +downstreamnt
atggctgcagagtctattcccacaccctccaacatggaggaaacacaacagaaatccaac
ctagagctgctccacatctctgtgctgctcatccagtcgtggctggagcctgtgcagttc
ctcaagagtgtgtttgccaacaggcaggtgtatggcacctcagacagcggcgtctatgac
ctcctaaaaagcctagaagaaggcatccaaacgctgatggggaggctggaagatggtagc
ccctggactgggcagatcttcaagcagacctacagcaagtttgacacaaactcgcacaat
gatgacacactgctcaagaactactggctgctccactgtttcaggaaggacatgaacaag
gtcgagacattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675500
Entry
104675500         CDS       T03989                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675500
   04151 PI3K-Akt signaling pathway
    104675500
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104675500
   04060 Cytokine-cytokine receptor interaction
    104675500
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104675500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675500
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104675500
SSDB
Motif
Pfam: Hormone_1 LURAP
Other DBs
NCBI-GeneID: 104675500
NCBI-ProteinID: XP_030779076
LinkDB
Position
19
AA seq 162 aa
MAAEACISKEQKYSFLRNTQTSLCFSESIQTPSNRKETQQKSNLELLYISVLLIQSWLEP
VQFLGSVFANSLVYGALNCNVYHYLKNLEEGIQTLMWRLDDGSPRTGQIFKQTYSKFDIN
SHNDDALLKNYRLLHCFSKDMDKVKTFLRTVQCLSVEGSCGF
NT seq 489 nt   +upstreamnt  +downstreamnt
atggctgcagaagcctgtatctcaaaggaacagaagtattcattcctgcggaacacccag
acctccctctgcttctcagagtctattcaaacaccctccaacaggaaagaaacacagcag
aaatccaacctagagctgctctacatctctgtgctgctcatccagtcgtggctggagccc
gtgcagttcctcgggagtgtgtttgccaacagcctggtgtatggtgccttgaactgcaac
gtctatcactacctaaagaacctagaggaaggcatccaaacgctgatgtggaggctggac
gatggcagcccccggactgggcagatcttcaagcagacctacagcaagtttgacataaac
tcgcacaacgatgacgcactgctcaagaactacaggctgctccactgcttcagcaaggac
atggacaaggtcaagacattcctgcgcacagtgcagtgcctctctgtggagggcagctgt
ggcttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675501
Entry
104675501         CDS       T03989                                 

Definition
(RefSeq) somatotropin-like isoform X1
  KO
K05438  growth hormone
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675501
   04151 PI3K-Akt signaling pathway
    104675501
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104675501
   04060 Cytokine-cytokine receptor interaction
    104675501
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104675501
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675501
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104675501
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104675501
NCBI-ProteinID: XP_030779074
LinkDB
Position
19
AA seq 248 aa
MAAGSRTSLLLAFALLCLPWLQEAGRVPSVPLSRLFDHAMIQAHRLHQLAFDTYQEFEET
YIPKEKKHSIMENPQASFCFSESIPTPANREETQQKSVSGCLLPQAGMWEAHGQSLCTAQ
PLCVLPLQNLELLRISLLLIQSWLEPVHLLGSVFANNLVYGTSESDVYDLLKNLEEGIQT
LMRRLEDGSPRTGQIFKQTYSKFDTDSHNDDSLLKNYGLLHCFRKDMDMVETFLRMVQCR
SVEGSCGF
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggcttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtcccaagcgtacccttatccaggctttttgaccacgctatg
atccaagcccatcgcctgcaccaactggcctttgacacctaccaggagtttgaagaaacc
tatatcccaaaggaaaagaagcattcgatcatggagaacccccaggcctccttctgcttc
tcagagtctattcccacacccgccaacagggaggaaacgcagcagaaatccgtgagtgga
tgccttctcccccaggcagggatgtgggaggcccatggtcagagcctctgtacagcacag
ccactgtgtgtccttcccctgcagaacctagagctgctccgcatctccctgttgctcatc
cagtcatggctggagcccgtgcatttactcgggagtgtgtttgccaacaacctggtgtat
ggcacctcggaaagcgatgtctatgacctcctaaagaacctagaggaaggcatccaaacg
ttgatgcggaggctggaagatggcagcccccggactgggcagatcttcaagcagacctac
agcaagtttgacacagactcgcacaacgatgattcactgctcaagaactatgggctgctc
cactgcttccggaaggacatggacatggtcgagacattcctgcgcatggtgcagtgccgc
tctgtggagggcagctgtggcttctag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675502
Entry
104675502         CDS       T03989                                 

Definition
(RefSeq) somatotropin-like isoform X1
  KO
K05438  growth hormone
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04080  Neuroactive ligand-receptor interaction
rro04151  PI3K-Akt signaling pathway
rro04630  JAK-STAT signaling pathway
rro04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104675502
   04151 PI3K-Akt signaling pathway
    104675502
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104675502
   04060 Cytokine-cytokine receptor interaction
    104675502
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104675502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104675502
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104675502
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104675502
NCBI-ProteinID: XP_030779065
LinkDB
Position
19
AA seq 180 aa
MIHAYRLHRLAFDTYQEFEEAYIPKQQKYSFLRNPQTSLCFSESIPTPSNMEETQQKSNL
ELLHISVLLIQSWLEPMQFLRSVFANRQVYGTSDSDVYDLLKHLEEGIQTLMVVKRLEDH
CPRTGQIFKQTYSKFDTNSHNDDTLFKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatccatgcctatcgcctgcaccggctggcctttgacacctaccaggagtttgaagaa
gcctatatcccaaagcaacagaaatattcattcctgcggaacccccagacctccctctgc
ttctcagagtctattcccacaccctccaacatggaggaaacacaacagaaatccaaccta
gagctgctccacatctctgtgctgctcatccagtcctggctggagcccatgcagttcctc
aggagtgtgtttgccaacaggcaggtgtatggcacctcggacagcgacgtctatgacctc
ctaaaacacctagaggaaggcatccaaacgctgatggtggtgaagaggctggaagaccac
tgcccccggactgggcagatcttcaagcagacctacagcaagtttgacacaaactcgcac
aatgatgacacactgttcaagaactacgggctgctccactgcttcaggaaggacatggac
aaggttgagacattcttgcgcatggtgcagtgccgctctgtggagggcagctgtggcttc
tag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680417
Entry
104680417         CDS       T03989                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04060  Cytokine-cytokine receptor interaction
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104680417 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104680417 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104680417 (CNTF)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  CSF and other factors
   104680417 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 104680417
NCBI-ProteinID: XP_010384664
UniProt: A0A2K6P7S5
LinkDB
Position
15
AA seq 200 aa
MAFAEHSPLTPHSRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSVDGVPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTKGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPHNEADGMPLSFGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQTGIPARGSHYIANNKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcgcagagcattcaccgctgacccctcacagtcgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttacggaatcttatgtgaag
catcagggcctgaacaagaacatcaacctggattctgtggatggggtgccagtggcaagc
actgatcagtggagtgagctgaccgaggcagagcgactccaagagaaccttcaagcttat
cgtaccttccatgttttgttggccaggcttttagaagaccagcaggtgcattttacccca
accaaaggtgacttccatcaagctatacatacccttcttctccaggttgctgcctttgca
taccagatagaggagttaatgatactcctggaatacaagattccccacaatgaggctgat
gggatgcctcttagttttggagatggtggtctctttgagaagaagctgtggggcctaaag
gtgctgcaggaactttcacagtggacagtgaggtccatccatgaccttcgtgtcatttct
tctcatcagactgggatcccagcacgtgggagccattatattgctaacaacaagaaaatg
tag

DBGET integrated database retrieval system