KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654803
Entry
104654803         CDS       T03989                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04110  Cell cycle
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05212  Pancreatic cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104654803 (E2F3)
   04218 Cellular senescence
    104654803 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104654803 (E2F3)
   05206 MicroRNAs in cancer
    104654803 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104654803 (E2F3)
   05225 Hepatocellular carcinoma
    104654803 (E2F3)
   05226 Gastric cancer
    104654803 (E2F3)
   05214 Glioma
    104654803 (E2F3)
   05220 Chronic myeloid leukemia
    104654803 (E2F3)
   05218 Melanoma
    104654803 (E2F3)
   05219 Bladder cancer
    104654803 (E2F3)
   05215 Prostate cancer
    104654803 (E2F3)
   05224 Breast cancer
    104654803 (E2F3)
   05222 Small cell lung cancer
    104654803 (E2F3)
   05223 Non-small cell lung cancer
    104654803 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104654803 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104654803 (E2F3)
   05161 Hepatitis B
    104654803 (E2F3)
   05160 Hepatitis C
    104654803 (E2F3)
   05163 Human cytomegalovirus infection
    104654803 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104654803 (E2F3)
   05169 Epstein-Barr virus infection
    104654803 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104654803 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104654803 (E2F3)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    104654803 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 104654803
NCBI-ProteinID: XP_010352402
UniProt: A0A2K6NHM1
LinkDB
Position
4
AA seq 465 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI
LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG
RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD
TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP
MKTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEG
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgctctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agcccaggcttcgccgccgccgccgccgctgccgccgccccgggcgcgtacatccagatc
ctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgccgtagcc
gccggccccctcctccccagtgcccccggcgcggagcagaccgccggcagcctcctctac
accacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagccctggga
cgcggcggcagcggcggcggcggcggccctccggcaaagcgaaggctggagctaggagaa
agtggtcatcagtacctctcagatggtttaaaaacccccaagggcaaaggaagagctgca
ctgcgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacgcggtatgat
acgtctcttggtctgctcaccaagaagttcattcagctcctgagccagtcacccgatggg
gtcttggatttgaacaaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgat
atcaccaacgttctggaaggcatccacctcattaagaagaagtctaaaaacaacgtccaa
tggatgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtca
aaagaagtgactgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgc
accctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttaca
tatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcc
cctccagaaacaagacttgaagtgcctgactcaatagagagcctacaaatacatttggca
agtacccaagggcccattgaggtttacttatgtccagaagagactgaaacacacagtcca
atgaaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagacttg
gcttcaaccaactcaggacatagcgattgctcaatttctatgggaaacctttctcctttg
gcctctccagccaacctcttacagcagactgaggaccaaattccttccaacctagaagga
ccgtttgtgaacttactgcctcccctgctgcaagaggactatctcctgagcctcggggag
gaggaaggcatcagcgatctctttgatgcttacgatttggaaaagctcccactggtggaa
gacttcatgtgtagttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656129
Entry
104656129         CDS       T03989                                 

Gene name
E2F2
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04110  Cell cycle
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05212  Pancreatic cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104656129 (E2F2)
   04218 Cellular senescence
    104656129 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104656129 (E2F2)
   05206 MicroRNAs in cancer
    104656129 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104656129 (E2F2)
   05225 Hepatocellular carcinoma
    104656129 (E2F2)
   05226 Gastric cancer
    104656129 (E2F2)
   05214 Glioma
    104656129 (E2F2)
   05220 Chronic myeloid leukemia
    104656129 (E2F2)
   05218 Melanoma
    104656129 (E2F2)
   05219 Bladder cancer
    104656129 (E2F2)
   05215 Prostate cancer
    104656129 (E2F2)
   05224 Breast cancer
    104656129 (E2F2)
   05222 Small cell lung cancer
    104656129 (E2F2)
   05223 Non-small cell lung cancer
    104656129 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104656129 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104656129 (E2F2)
   05161 Hepatitis B
    104656129 (E2F2)
   05160 Hepatitis C
    104656129 (E2F2)
   05163 Human cytomegalovirus infection
    104656129 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104656129 (E2F2)
   05169 Epstein-Barr virus infection
    104656129 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104656129 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104656129 (E2F2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    104656129 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 104656129
NCBI-ProteinID: XP_010354070
UniProt: A0A2K6P1B6
LinkDB
Position
12
AA seq 437 aa
MLQGPRALVSAAGQPPKVVPAMSPTELWPSGLSSPQLCPATTSYYTPLYPQTAPPAVAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKI
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNMEEALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDPAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
LPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggtttcggccgctgggcagcccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actaccagctactacacgccgctgtacccgcagacggcgcctcccgcagtggcgcccggc
acctgcctcgacgccactccccacggacccgagggccaagttgttcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaatc
cccaaatcccctggggagaagactcggtatgacacttcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgcttgagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatg
gaggaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgcct
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcccctcccctct
acctccaccctctgccccagccctgaccctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ctgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcatgcagctcccctctg
atcagcttctccccgtccttggatcaggatgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgacctcggggacctgttgattaattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660298
Entry
104660298         CDS       T03989                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04110  Cell cycle
rro04137  Mitophagy - animal
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05212  Pancreatic cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104660298 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    104660298 (E2F1)
   04218 Cellular senescence
    104660298 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104660298 (E2F1)
   05206 MicroRNAs in cancer
    104660298 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104660298 (E2F1)
   05225 Hepatocellular carcinoma
    104660298 (E2F1)
   05226 Gastric cancer
    104660298 (E2F1)
   05214 Glioma
    104660298 (E2F1)
   05220 Chronic myeloid leukemia
    104660298 (E2F1)
   05218 Melanoma
    104660298 (E2F1)
   05219 Bladder cancer
    104660298 (E2F1)
   05215 Prostate cancer
    104660298 (E2F1)
   05224 Breast cancer
    104660298 (E2F1)
   05222 Small cell lung cancer
    104660298 (E2F1)
   05223 Non-small cell lung cancer
    104660298 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104660298 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104660298 (E2F1)
   05161 Hepatitis B
    104660298 (E2F1)
   05160 Hepatitis C
    104660298 (E2F1)
   05163 Human cytomegalovirus infection
    104660298 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104660298 (E2F1)
   05169 Epstein-Barr virus infection
    104660298 (E2F1)
   05165 Human papillomavirus infection
    104660298 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104660298 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104660298 (E2F1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    104660298 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 104660298
NCBI-ProteinID: XP_030770478
LinkDB
Position
13
AA seq 437 aa
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVSGRLEGLTEDLRQLQESEQQLDHLMSICTTQLRMLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccttggccggggcccctgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctgccgcgcag
gacgccagcgccccgccggctcccaccggccccgcggcgcccgccgccggcccctgcgac
cctgacctgctgctcttcgccacaccgcaggcgccccggcccacacccagtgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggttggacctggaaactgaccatcagtac
ctggcggagagcagtgggccagctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctg
gagctgctgagccgctcggctgacggtgtcgtcgacctgaactgggctgctgaggtgctg
aaagtgcagaagcggcgcatctatgacatcaccaacgtcctcgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggtagccacaccacagtgggcgtcagc
gggcggcttgaggggttgaccgaggacctccggcagctgcaggagagcgagcagcagctg
gaccacctgatgagtatctgtactacgcagctgcgcatgctctccgaggatactgacagc
cagcgcctggcctatgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcccgagacccagctccaagccgtggactcttcggag
acctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgag
gagaccgtgggtgggatcagccctgggaagaccccgtcccaggaggccacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctcccccctca
tccctcaccacagatcccagtcagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggtgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

DBGET integrated database retrieval system